From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002355000
  • symbol?:
  • description?: hypothetical protein
  • strand?: +
  • coordinates?: 2894492..2894762
  • synteny block?: BlockID0016540
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0555
    08BA02176:
    C248_0653
    11819-97:
    MS7_0567
    71193:
    ST398NM01_0652
    ECT-R 2:
    ECTR2_531
    ED133:
    SAOV_0612
    ED98:
    SAAV_0540
    HO 5096 0412:
    SAEMRSA15_05050
    JH1:
    SaurJH1_0615
    JH9:
    SaurJH9_0601
    JKD6008:
    SAA6008_00585
    JKD6159:
    SAA6159_00531
    LGA251:
    SARLGA251_05130
    M013:
    M013TW_0565
    MRSA252:
    SAR0583
    MSHR1132:
    SAMSHR1132_05210
    MSSA476:
    SAS0536
    Mu3:
    SAHV_0576
    Mu50:
    SAV0578
    MW2:
    MW0533
    RF122:
    SAB0528
    ST398:
    SAPIG0652
    T0131:
    SAT0131_00638
    TCH60:
    HMPREF0772_12611
    TW20:
    SATW20_06470
    USA300_TCH1516:
    USA300HOU_0571
    VC40:
    SAVC_02475

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKFNEIWINEYLALVNDDNPIHNEIVPGQLVSQMMLMAMSLETNQCQINYVKPILINENI
    N315            MKFNEIWINEYLALVNDDNPIHNEIVPGQLVSQMMLMAMSLETNQCQINYVKPILINENI
    NCTC8325        MEFNEIWINEYLALVNDDNPIHNEIVPGQLVSQMMLMAMSLETNQCQINYVKPILINENI
    Newman          MKFNEIWINEYLALVNDDNPIHNEIVPGQLVSQMMLMAMSLETNQCQINYVKPILINENI
                    *:**********************************************************

    COL             EFIEQHEHEIIAINDDGEIKIKISLSTKK
    N315            EFIEQHEHEIIAINDDGEIKIKISLSTKK
    NCTC8325        EFIEQHEHEIIAINDDGEIKIKISLSTKK
    Newman          EFIEQHEHEIIAINDDGEIKIKISLSTKK
                    *****************************