From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002360000
  • symbol?:
  • description?: hypothetical protein
  • strand?: +
  • coordinates?: 2899486..2899866
  • synteny block?: BlockID0016590
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0559
    08BA02176:
    C248_0657
    11819-97:
    MS7_0571
    71193:
    ST398NM01_0656
    ECT-R 2:
    ECTR2_535
    ED133:
    SAOV_0616
    ED98:
    SAAV_0544
    HO 5096 0412:
    SAEMRSA15_05090
    JH1:
    SaurJH1_0619
    JH9:
    SaurJH9_0605
    JKD6008:
    SAA6008_00589
    JKD6159:
    SAA6159_00535
    LGA251:
    SARLGA251_05170
    M013:
    M013TW_0569
    MRSA252:
    SAR0587
    MSHR1132:
    SAMSHR1132_05260
    MSSA476:
    SAS0540
    Mu3:
    SAHV_0580
    Mu50:
    SAV0582
    MW2:
    MW0537
    RF122:
    SAB0532
    ST398:
    SAPIG0656
    T0131:
    SAT0131_00643
    TCH60:
    HMPREF0772_12607
    TW20:
    SATW20_06510
    USA300_TCH1516:
    USA300HOU_0575
    VC40:
    SAVC_02495

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MLNRETLIARIEQELVQAEQAQHDHDFEKHMYAIHILTSLYASTSNTPHIGEQQMNRRIA
    N315            MVNRETLIARIEQELVQAEQAQHDHDFEKHMYAIHILTSLYASTSNTPHIGEQQMNRRIA
    NCTC8325        MLNRETLIARIEQELVQAEQAQHDHDFEKHMYAIHILTSLYASTSNTPHIGEQQMNRRIA
    Newman          MLNRETLIARIEQELVQAEQAQHDHDFEKHMYAIHILTSLYASTSNTPHIGEQQMNRRIA
    USA300_FPR3757  MLNRETLIARIEQELVQAEQAQHDHDFEKHMYAIHILTSLYASTSNTPHIGEQQMNRRIA
                    *:**********************************************************

    COL             NHNQMPQSQITQPTHQVTVAEIEAMGGKVNTHSAHHHNKSYSQPSNQQQRLATDDDIGNG
    N315            NHNQMPQSQITQPTHQVTAAEIEAMGGKVNTHSAHHHNKSYSQPSNQQQRLATDDDIGNG
    NCTC8325        NHNQMPQSQITQPTHQVTVAEIEAMGGKVNTHSAHHHNKSYSQPSNQQQRLATDDDIGNG
    Newman          NHNQMPQSQITQPTHQVTVAEIEAMGGKVNTHSAHHHNKSYSQPSNQQQRLATDDDIGNG
    USA300_FPR3757  NHNQMPQSQITQPTHQVTVAEIEAMGGKVNTHSAHHHNKSYSQPSNQQQRLATDDDIGNG
                    ******************.*****************************************

    COL             ESIFDF
    N315            ESIFDF
    NCTC8325        ESIFDF
    Newman          ESIFDF
    USA300_FPR3757  ESIFDF
                    ******