From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002362000
  • symbol?:
  • description?: amino acid permease

      descriptions from strain specific annotations:

    • amino acid permease
    • Amino acid permease-associated region
    • amino acid permease family protein
    • APC family amino acid-polyamine-organocation transporter
    • arginine permease
    • cationic amino acid transporter
    • putative amino acid permease
  • strand?: +
  • coordinates?: 2900453..2901973
  • synteny block?: BlockID0016610
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0561
    08BA02176:
    C248_0659
    11819-97:
    MS7_0573
    71193:
    ST398NM01_0658
    ECT-R 2:
    ECTR2_537
    ED133:
    SAOV_0618
    ED98:
    SAAV_0546
    HO 5096 0412:
    SAEMRSA15_05110
    JH1:
    SaurJH1_0621
    JH9:
    SaurJH9_0607
    JKD6008:
    SAA6008_00591
    JKD6159:
    SAA6159_00537
    LGA251:
    SARLGA251_05190
    M013:
    M013TW_0571
    MRSA252:
    SAR0589
    MSHR1132:
    SAMSHR1132_05280
    MSSA476:
    SAS0542
    Mu3:
    SAHV_0582
    Mu50:
    SAV0584
    MW2:
    MW0539
    RF122:
    SAB0534
    ST398:
    SAPIG0658
    T0131:
    SAT0131_00645
    TCH60:
    HMPREF0772_12605
    TW20:
    SATW20_06530
    USA300_TCH1516:
    USA300HOU_0577
    VC40:
    SAVC_02505

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MEKKNKQIDRGDLKQNLSEKFVWAIAYGSCIGWGAFIIPGDWIKQSGPIAASIGIVIGAL
    N315            MEKKNKQIDRGDLKQNLSEKFVWAIAYGSCIGWGAFILPGDWIKQSGPIAASIGIVIGAL
    NCTC8325        MEKKNKQIDRGDLKQNLSEKFVWAIAYGSCIGWGAFILPGDWIKQSGPIAASIGIVIGAL
    Newman          MEKKNKQIDRGDLKQNLSEKFVWAIAYGSCIGWGAFILPGDWIKQSGPIAASIGIVIGAL
    USA300_FPR3757  MEKKNKQIDRGDLKQNLSEKFVWAIAYGSCIGWGAFILPGDWIKQSGPIAASIGIVIGAL
                    *************************************:**********************

    COL             LMILIAVSYGALVERFPVSGGAFAFSFLSFGRYVSFFSSWFLTFGYVCVVALNATAFSLL
    N315            LMILIAVSYGALVERFPVSGGAFAFSFLSFGRYVSFFSSWFLTFGYVCVVALNATAFSLL
    NCTC8325        LMILIAVSYGALVERFPVSGGAFAFSFLSFGRYVSFFSSWFLTFGYVCVVALNATAFSLL
    Newman          LMILIAVSYGALVERFPVSGGAFAFSFLSFGRYVSFFSSWFLTFGYVCVVALNATAFSLL
    USA300_FPR3757  LMILIAVSYGALVERFPVSGGAFAFSFLSFGRYVSFFSSWFLTFGYVCVVALNATAFSLL
                    ************************************************************

    COL             VKFLLPDVLNNGKLYTIAGWDVYITEIIIATVLLLVFMLVTIRGASVSGSLQYYFCVAMV
    N315            VKFLLPDVLNNGKLYTIAGWDVYITEIIIATVLLLVFMLVTIRGASVSGSLQYYFCVAMV
    NCTC8325        VKFLLPDVLNNGKLYTIAGWDVYITEIIIATVLLLVFMLVTIRGASVSGSLQYYFCVAMV
    Newman          VKFLLPDVLNNGKLYTIAGWDVYITEIIIATVLLLVFMLVTIRGASVSGSLQYYFCVAMV
    USA300_FPR3757  VKFLLPDVLNNGKLYTIAGWDVYITEIIIATVLLLVFMLVTIRGASVSGSLQYYFCVAMV
                    ************************************************************

    COL             IVVLLMFFGSFFGNNFALENLQPLAEPSKGWLVSIVVIVSVAPWAYVGFDNIPQTAEEFN
    N315            IVVLLMFFGSFFGNNFALENLQPLAEPSKGWLVSIVVIVSVAPWAYVGFDNIPQTAEEFN
    NCTC8325        IVVLLMFFGSFFGNNFALENLQPLAEPSKGWLVSIVVIVSVAPWAYVGFDNIPQTAEEFN
    Newman          IVVLLMFFGSFFGNNFALENLQPLAEPSKGWLVSIVVIVSVAPWAYVGFDNIPQTAEEFN
    USA300_FPR3757  IVVLLMFFGSFFGNNFALENLQPLAEPSKGWLVSIVVIVSVAPWAYVGFDNIPQTAEEFN
                    ************************************************************

    COL             FAPNKTFKLIVYSLLAASLTYVVMILYTGWLSTSHQSLNGQLWLTGAVTQTAFGYIGLGV
    N315            FAPNKTFKLIVYSLLAASLTYVVMILYTGWLSTSHQSLNGQLWLTGAVTQTAFGYIGLGV
    NCTC8325        FAPNKTFKLIVYSLLAASLTYVVMILYTGWLSTSHQSLNGQLWLTGAVTQTAFGYIGLGV
    Newman          FAPNKTFKLIVYSLLAASLTYVVMILYTGWLSTSHQSLNGQLWLTGAVTQTAFGYIGLGV
    USA300_FPR3757  FAPNKTFKLIVYSLLAASLTYVVMILYTGWLSTSHQSLNGQLWLTGAVTQTAFGYIGLGV
                    ************************************************************

    COL             LAIAIMMGIFTGLNGFLMSSSRLLFSMGRSGIMPTMFSKLHSKYKTPYVAIIFLVGVSLI
    N315            LAIAIMMGIFTGLNGFLMSSSRLLFSMGRSGIMPTMFSKLHSKYKTPYVAIIFLVGVSLI
    NCTC8325        LAIAIMMGIFTGLNGFLMSSSRLLFSMGRSGIMPTMFSKLHSKYKTPYVAIIFLVGVSLI
    Newman          LAIAIMMGIFTGLNGFLMSSSRLLFSMGRSGIMPTMFSKLHSKYKTPYVAIIFLVGVSLI
    USA300_FPR3757  LAIAIMMGIFTGLNGFLMSSSRLLFSMGRSGIMPTMFSKLHSKYKTPYVAIIFLVGVSLI
                    ************************************************************

    COL             APWLGRTALTWIVDMSSTGVSIAYFITCLSAAKLFSYNKQSNTYAPVYKTFAIIGSFVSF
    N315            APWLGRTALTWIVDMSSTGVSIAYFITCLSAAKLFSYNKQSNTYAPVYKTFAIIGSFVSF
    NCTC8325        APWLGRTALTWIVDMSSTGVSIAYFITCLSAAKLFSYNKQSNTYAPVYKTFAIIGSFVSF
    Newman          APWLGRTALTWIVDMSSTGVSIAYFITCLSAAKLFSYNKQSNTYAPVYKTFAIIGSFVSF
    USA300_FPR3757  APWLGRTALTWIVDMSSTGVSIAYFITCLSAAKLFSYNKQSNTYAPVYKTFAIIGSFVSF
                    ************************************************************

    COL             IFLALLLVPGSPAALTAPSYIALLGWLIIGLIFFVIRYPKLKNMDNDELSRLILNRSENE
    N315            IFLALLLVPGSPAALTAPSYIALLGWLIIGLIFFVIRYPKLKNMDNDELSRLILNRSENE
    NCTC8325        IFLALLLVPGSPAALTAPSYIALLGWLIIGLIFFVIRYPKLKNMDNDELSRLILNRSENE
    Newman          IFLALLLVPGSPAALTAPSYIALLGWLIIGLIFFVIRYPKLKNMDNDELSRLILNRSENE
    USA300_FPR3757  IFLALLLVPGSPAALTAPSYIALLGWLIIGLIFFVIRYPKLKNMDNDELSRLILNRSENE
                    ************************************************************

    COL             VDDMIEEPEKEKTK
    N315            VDDMIEEPEKEKTK
    NCTC8325        VDDMIEEPEKEKTK
    Newman          VDDMIEEPEKEKTK
    USA300_FPR3757  VDDMIEEPEKEKTK
                    **************