Due to technical reasons this service will not be available for 7 days from 27 Nov to 04 Dec 2017
From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002364000
  • symbol?:
  • description?: membrane protein

      descriptions from strain specific annotations:

    • membrane protein
    • Threonine/Serine Exporter
  • strand?: -
  • coordinates?: 2902582..2903232
  • synteny block?: BlockID0016630
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0563
    08BA02176:
    C248_0661
    11819-97:
    MS7_0575
    71193:
    ST398NM01_0660
    ECT-R 2:
    ECTR2_539
    ED133:
    SAOV_0620c
    ED98:
    SAAV_0548
    HO 5096 0412:
    SAEMRSA15_05130
    JH1:
    SaurJH1_0623
    JH9:
    SaurJH9_0609
    JKD6008:
    SAA6008_00593
    JKD6159:
    SAA6159_00539
    LGA251:
    SARLGA251_05210
    M013:
    M013TW_0573
    MRSA252:
    SAR0591
    MSHR1132:
    SAMSHR1132_05300
    MSSA476:
    SAS0544
    Mu3:
    SAHV_0584
    Mu50:
    SAV0586
    MW2:
    MW0541
    RF122:
    SAB0536c
    ST398:
    SAPIG0660
    T0131:
    SAT0131_00648
    TCH60:
    HMPREF0772_12603
    TW20:
    SATW20_06550
    USA300_TCH1516:
    USA300HOU_0579
    VC40:
    SAVC_02515

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MDINSEEYKQEVLIKDVVMLAARILLESGAEGTRVEDTMTRIAKKLGYSESNSFVTNTVI
    N315            --------------------------------------MTRIAKKLGYSESNSFVTNTVI
    NCTC8325        --------------------------------------MTRIAKKLGYSESNSFVTNTVI
    Newman          MDINSEEYKQEVLIKDVVMLAARILLESGAEGTRVEDTMTRIAKKLGYSESNSFVTNTVI
    USA300_FPR3757  --------------------------------------MTRIAKKLGYSESNSFVTNTVI
                                                          **********************

    COL             QFTLHSESFPRIFRITSRDTNLIKISQANKISRQITNNEISLAEAKTQLEKIYVAKRDSS
    N315            QFTLHSESFPRIFRITSRDTNLIKISQANKISRQITNNEISLAEAKTQLEKIYVAKRDSS
    NCTC8325        QFTLHSESFPRIFRITSRDTNLIKISQANKISRQITNNEISLAEAKTQLEKIYVAKRDSS
    Newman          QFTLHSESFPRIFRITSRDTNLIKISQANKISRQITNNEISLAEAKTQLEKIYVAKRDSS
    USA300_FPR3757  QFTLHSESFPRIFRITSRDTNLIKISQANKISRQITNNEISLAEAKTQLEKIYVAKRDSS
                    ************************************************************

    COL             LPFKGFAAAMIAMSFLYLQGGRLIDVLTAILAGSLGYLVTEILDRKLHAQFIPEFIGSLV
    N315            LPFKGFAAAMIAMSFLYLQGGRLIDVLTAILAGSLGYLVTEILDRKLHAQFIPEFIGSLV
    NCTC8325        LPFKGFAAAMIAMSFLYLQGGRLIDVLTAILAGSLGYLVTEILDRKLHAQFIPEFIGSLV
    Newman          LPFKGFAAAMIAMSFLYLQGGRLIDVLTAILAGSLGYLVTEILDRKLHAQFIPEFIGSLV
    USA300_FPR3757  LPFKGFAAAMIAMSFLYLQGGRLIDVLTAILAGSLGYLVTEILDRKLHAQFIPEFIGSLV
                    ************************************************************

    COL             IGIIAVIGHTLIPTGDLATIIIAAVMPIVPGVLITNAIQDLFGGHMLMFTTKSLEALVTA
    N315            IGIIAVIGHTLIPTGDLATIIIAAVMPIVPGVLITNAIQDLFGGHMLMFTTKSLEALVTA
    NCTC8325        IGIIAVIGHTLIPTGDLATIIIAAVMPIVPGVLITNAIQDLFGGHMLMFTTKSLEALVTA
    Newman          IGIIAVIGHTLIPTGDLATIIIAAVMPIVPGVLITNAIQDLFGGHMLMFTTKSLEALVTA
    USA300_FPR3757  IGIIAVIGHTLIPTGDLATIIIAAVMPIVPGVLITNAIQDLFGGHMLMFTTKSLEALVTA
                    ************************************************************

    COL             FGIGAGVGSVLILV
    N315            FGIGAGVGSVLILV
    NCTC8325        FGIGAGVGSVLILV
    Newman          FGIGAGVGSVLILV
    USA300_FPR3757  FGIGAGVGSVLILV
                    **************