From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002367000
  • symbol?: hemQ
  • description?: heme-binding protein

      descriptions from strain specific annotations:

    • heme-binding protein
    • heme peroxidase
    • putative heme peroxidase
    • chlorite dismutase family protein
    • chlorite O(2)-lyase
    • chlorite O2-lyase
    • Hemo protein HemQ, essential component of hemebiosynthetic pathway in Gram-positive bacteria
  • strand?: -
  • coordinates?: 2904640..2905392
  • synteny block?: BlockID0016660
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0564
    08BA02176:
    C248_0662
    11819-97:
    MS7_0576
    71193:
    ST398NM01_0661
    ECT-R 2:
    ECTR2_540
    ED133:
    SAOV_0621c
    ED98:
    SAAV_0549
    HO 5096 0412:
    SAEMRSA15_05150
    JH1:
    SaurJH1_0625
    JH9:
    SaurJH9_0610
    JKD6008:
    SAA6008_00594
    JKD6159:
    SAA6159_00540
    LGA251:
    SARLGA251_05220
    M013:
    M013TW_0575
    MRSA252:
    SAR0593
    MSHR1132:
    SAMSHR1132_05310
    MSSA476:
    SAS0546
    Mu3:
    SAHV_0585
    Mu50:
    SAV0587
    MW2:
    MW0542
    RF122:
    SAB0537c
    ST398:
    SAPIG0661
    T0131:
    SAT0131_00649
    TCH60:
    HMPREF0772_12601 (ywfI)
    TW20:
    SATW20_06560
    USA300_TCH1516:
    USA300HOU_0580
    VC40:
    SAVC_02520

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSQAAETLDGWYSLHLFYAVDWASLRIVPKDERDALVTEFQSFLENTATVRSSKSGDQAI
    N315            MSQAAETLDGWYSLHLFYAVDWASLRIVPKDERDALVTEFQSFLENTATVRSSKSGDQAI
    NCTC8325        MSQAAETLDGWYSLHLFYAVDWASLRIVPKDERDALVTEFQSFLENTATVRSSKSGDQAI
    Newman          MSQAAETLDGWYSLHLFYAVDWASLRIVPKDERDALVTEFQSFLENTATVRSSKSGDQAI
    USA300_FPR3757  MSQAAETLDGWYSLHLFYAVDWASLRIVPKDERDALVTEFQSFLENTATVRSSKSGDQAI
                    ************************************************************

    COL             YNITGQKADLLLWFLRPEMKSLNHIENEFNKLRIADFLIPTYSYVSVIELSNYLAGKSDE
    N315            YNITGQKADLLLWFLRPEMKSLNHIENEFNKLRIADFLIPTYSYVSVIELSNYLAGKSDE
    NCTC8325        YNITGQKADLLLWFLRPEMKSLNHIENEFNKLRIADFLIPTYSYVSVIELSNYLAGKSDE
    Newman          YNITGQKADLLLWFLRPEMKSLNHIENEFNKLRIADFLIPTYSYVSVIELSNYLAGKSDE
    USA300_FPR3757  YNITGQKADLLLWFLRPEMKSLNHIENEFNKLRIADFLIPTYSYVSVIELSNYLAGKSDE
                    ************************************************************

    COL             DPYENPHIKARLYPELPHSDYICFYPMNKRRNETYNWYMLTMEERQKLMYDHGMIGRKYA
    N315            DPYENPHIKARLYPELPHSDYICFYPMNKRRNETYNWYMLTMEERQKLMYDHGMIGRKYA
    NCTC8325        DPYENPHIKARLYPELPHSDYICFYPMNKRRNETYNWYMLTMEERQKLMYDHGMIGRKYA
    Newman          DPYENPHIKARLYPELPHSDYICFYPMNKRRNETYNWYMLTMEERQKLMYDHGMIGRKYA
    USA300_FPR3757  DPYENPHIKARLYPELPHSDYICFYPMNKRRNETYNWYMLTMEERQKLMYDHGMIGRKYA
                    ************************************************************

    COL             GKIKQFITGSVGFDDFEWGVTLFSDDVLQFKKIVYEMRFDETTARYGEFGSFFVGHIINT
    N315            GKIKQFITGSVGFDDFEWGVTLFSDDVLQFKKIVYEMRFDETTARYGEFGSFFVGHLINT
    NCTC8325        GKIKQFITGSVGFDDFEWGVTLFSDDVLQFKKIVYEMRFDETTARYGEFGSFFVGHIINT
    Newman          GKIKQFITGSVGFDDFEWGVTLFSDDVLQFKKIVYEMRFDETTARYGEFGSFFVGHIINT
    USA300_FPR3757  GKIKQFITGSVGFDDFEWGVTLFSDDVLQFKKIVYEMRFDETTARYGEFGSFFVGHIINT
                    ********************************************************:***

    COL             NEFDQFFAIS
    N315            NEFDQFFAIS
    NCTC8325        NEFDQFFAIS
    Newman          NEFDQFFAIS
    USA300_FPR3757  NEFDQFFAIS
                    **********