From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002369000
  • symbol?: lipL
  • description?: lipoate-protein ligase A

      descriptions from strain specific annotations:

    • lipoate-protein ligase A
    • lipoate-protein ligase A-like protein
    • lipoate-protein ligase A protein
    • lipoate-protein ligase A family protein
    • protein N-octanoyltransferase
  • strand?: +
  • coordinates?: 2906549..2907385
  • synteny block?: BlockID0016680
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0566
    08BA02176:
    C248_0664
    11819-97:
    MS7_0578 (lipL)
    71193:
    ST398NM01_0663
    ECT-R 2:
    ECTR2_542
    ED133:
    SAOV_0623
    ED98:
    SAAV_0551
    HO 5096 0412:
    SAEMRSA15_05170
    JH1:
    SaurJH1_0627
    JH9:
    SaurJH9_0612
    JKD6008:
    SAA6008_00596 (lplA2)
    JKD6159:
    SAA6159_00542 (lplA2)
    LGA251:
    SARLGA251_05240
    M013:
    M013TW_0577
    MRSA252:
    SAR0595
    MSHR1132:
    SAMSHR1132_05330
    MSSA476:
    SAS0548
    Mu3:
    SAHV_0587
    Mu50:
    SAV0589
    MW2:
    MW0544
    RF122:
    SAB0539
    ST398:
    SAPIG0663
    T0131:
    SAT0131_00651
    TCH60:
    HMPREF0772_12599
    TW20:
    SATW20_06580
    USA300_TCH1516:
    USA300HOU_0582 (lplA2)
    VC40:
    SAVC_02530

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MDLASKYFNGVNWRYIDHSSGLEPMQSFAFDDTFCESVGKDISDNVVRTWIHQHTVILGI
    N315            MDLASKYFNGVNWRYIDHSSGLEPMQSFAFDDTFCESVGKDISDNVVRTWIHQHTVILGI
    NCTC8325        ------------------------MQSFAFDDTFCESVGKDISDNVVRTWIHQHTVILGI
    Newman          MDLASKYFNGVNWRYIDHSSGLEPMQSFAFDDTFCESVGKDISDNVVRTWIHQHTVILGI
    USA300_FPR3757  ------------------------MQSFAFDDTFCESVGKDISDNVVRTWIHQHTVILGI
                                            ************************************

    COL             HDSRLPFLKDGIDYLTNEIGYNAIVRNSGGLGVVLDQGVLNISLMFKGQTETTIDEAFTV
    N315            HDSRLPFLKDGIDYLTNEIGYNAIVRNSGGLGVVLDQGVLNISLMFKGQTETTIDEAFTV
    NCTC8325        HDSRLPFLKDGIDYLTNEIGYNAIVRNSGGLGVVLDQGVLNISLMFKGQTETTIDEAFTV
    Newman          HDSRLPFLKDGIDYLTNEIGYNAIVRNSGGLGVVLDQGVLNISLMFKGQTETTIDEAFTV
    USA300_FPR3757  HDSRLPFLKDGIDYLTNEIGYNAIVRNSGGLGVVLDQGVLNISLMFKGQTETTIDEAFTV
                    ************************************************************

    COL             MYLLISKMFENENVDIDTMEIEHSYCPGKFDLSIDGKKFAGISQRRVRGGIAVQIYLCVE
    N315            MYLLISKMFEDENVDIDTMEIEHSYCPGKFDLSIDGKKFAGISQRRVRGGIAVQIYLCVE
    NCTC8325        MYLLISKMFENENVDIDTMEIEHSYCPGKFDLSIDGKKFAGISQRRVRGGIAVQIYLCVE
    Newman          MYLLISKMFENENVDIDTMEIEHSYCPGKFDLSIDGKKFAGISQRRVRGGIAVQIYLCVE
    USA300_FPR3757  MYLLISKMFENENVDIDTMEIEHSYCPGKFDLSIDGKKFAGISQRRVRGGIAVQIYLCVE
                    **********:*************************************************

    COL             GSGSERALMMQTFYEHALKGEVTKFKYPEIEPSCMASLETLLNKTITVQDVMFLLLYAIK
    N315            GSGSERALMMQTFYEHALKGEVTKFKYPEIEPSCMASLETLLNKTITVQDVMFLLLYAIK
    NCTC8325        GSGSERALMMQTFYEHALKGEVTKFKYPEIEPSCMASLETLLNKTITVQDVMFLLLYAIK
    Newman          GSGSERALMMQTFYEHALKGEVTKFKYPEIEPSCMASLETLLNKTITVQDVMFLLLYAIK
    USA300_FPR3757  GSGSERALMMQTFYEHALKGEVTKFKYPEIEPSCMASLETLLNKTITVQDVMFLLLYAIK
                    ************************************************************

    COL             DLGGVLNMTPITQEEWQRYDTYFDKMIERNKKMIDQMQ
    N315            DLGGVLNMTPITQEEWQRYDTYFDKMIERNKKMIDQMQ
    NCTC8325        DLGGVLNMTPITQEEWQRYDTYFDKMIERNKKMIDQMQ
    Newman          DLGGVLNMTPITQEEWQRYDTYFDKMIERNKKMIDQMQ
    USA300_FPR3757  DLGGVLNMTPITQEEWQRYDTYFDKMIERNKKMIDQMQ
                    **************************************