From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002438000
  • symbol?:
  • description?: BadM/Rrf2 family transcriptional regulator

      descriptions from strain specific annotations:

    • BadM/Rrf2 family transcriptional regulator
    • transcriptional regulator family protein
    • putative DNA-binding protein
    • AsnC family transcriptional regulator
    • probable DNA-binding protein
    • Rrf2 family protein
    • putative Rrf2 family transcriptional regulator protein
  • strand?: -
  • coordinates?: 2957440..2957856
  • synteny block?: BlockID0016760
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0572
    08BA02176:
    C248_0671
    11819-97:
    MS7_0646
    71193:
    ST398NM01_0669
    ECT-R 2:
    ECTR2_548
    ED133:
    SAOV_0629c
    ED98:
    SAAV_0558
    HO 5096 0412:
    SAEMRSA15_05230
    JH1:
    SaurJH1_0633
    JH9:
    SaurJH9_0618
    JKD6008:
    SAA6008_00602
    JKD6159:
    SAA6159_00548
    LGA251:
    SARLGA251_05300
    M013:
    MRSA252:
    SAR0601
    MSHR1132:
    SAMSHR1132_05390
    MSSA476:
    SAS0554
    Mu3:
    SAHV_0593
    Mu50:
    SAV0595
    MW2:
    MW0550
    RF122:
    SAB0545c
    ST398:
    SAPIG0669
    T0131:
    SAT0131_00658
    TCH60:
    HMPREF0772_12593
    TW20:
    SATW20_06640
    USA300_TCH1516:
    USA300HOU_0588
    VC40:
    SAVC_02560

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNLEFNIAVHVLAFLTKHHSEKFNSSSLAELTCLNPVQLRRVTTQLVDLKMIDTIRGKDG
    N315            MNLEFNIAVHVLAFLTKHHSEKFNSSSLAELTCLNPVQLRRVTTQLVDLKMIDTIRGKDG
    NCTC8325        --------MHVLAFLTKHHSEKFNSSSLAELTCLNPVQLRRVTTQLVDLKMIDTIRGKDG
    Newman          MNLEFNIAVHVLAFLTKHHSEKFNSSSLAELTCLNPVQLRRVTTQLVDLKMIDTIRGKDG
    USA300_FPR3757  --------MHVLAFLTKHHSEKFNSSSLAELTCLNPVQLRRVTTQLVDLKMIDTIRGKDG
                            :***************************************************

    COL             GYLANDQSADVSLATLYKHFVLEKEHHTRLFTGDEGSHCQIARNIATTMSHYQQDEQNII
    N315            GYLANDQSADVSLATLYKHFVLEKEHHTRLFTGDEGSHCQIARNIATTMSHYQQDEQNII
    NCTC8325        GYLANDQSADVSLATLYKHFVLEKEHHTRLFTGDEGSHCQIARNIATTMSHYQQDEQNII
    Newman          GYLANDQSADVSLATLYKHFVLEKEHHTRLFTGDEGSHCQIARNIATTMSHYQQDEQNII
    USA300_FPR3757  GYLANDQSADVSLATLYKHFVLEKEHHTRLFTGDEGSHCQIARNIATTMSHYQQDEQNII
                    ************************************************************

    COL             INFYNGKTIKDVIEDIQKEDLCHENI
    N315            INFYNEKTIKDVIEDIQKEDLCHENI
    NCTC8325        INFYNGKTIKDVIEDIQKEDLCHENI
    Newman          INFYNGKTIKDVIEDIQKEDLCHENI
    USA300_FPR3757  INFYNGKTIKDVIEDIQKEDLCHENI
                    ***** ********************