From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40

Summary[edit source | edit]

  • pan ID?: SAUPAN002453000
  • symbol?:
  • description?: DUF443 domain-containing protein
  • strand?: +
  • coordinates?: 2963370..2964604
  • synteny block?: BlockID0016900
  • occurrence?: in 41% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    08BA02176:
    11819-97:
    MS7_0649
    71193:
    ECT-R 2:
    ED133:
    ED98:
    HO 5096 0412:
    JH1:
    JH9:
    JKD6008:
    SAA6008_00607
    JKD6159:
    LGA251:
    SARLGA251_05330
    M013:
    M013TW_0587
    MRSA252:
    MSHR1132:
    MSSA476:
    SAS0559
    Mu3:
    Mu50:
    MW2:
    MW0555
    RF122:
    ST398:
    T0131:
    SAT0131_00664
    TCH60:
    TW20:
    SATW20_06690
    USA300_TCH1516:
    USA300HOU_0595
    VC40:
    SAVC_02585

Genome Viewer[edit source | edit]

COL chromosome
NCTC8325 chromosome
Newman chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MLCESRVINQNPKYRIIKYNNEYFMVDLVSTWIAYFLPMINWFIPKKYAKISREEFESLN
    NCTC8325        MLCESRVINQNPKYRIIKYNNEYFMVDLVSTWIAYFLPMINWFIPKKYAKISREEFESLN
    Newman          MLCESRVINQNPKYRIIKYNNEYFMVDLVSTWIAYFLPMINWFIPKKYAKISREEFESLN
                    ************************************************************

    COL             IVKPAKNNTFWPVAGFAVLLTTLTRKYIYLLNIHLEKEIVILTCCMILLGVFALFIYINT
    NCTC8325        IVKPAKNNTFWPVAGFAVLLTTLTRKYIYLLNIHLEKEIVILTCCMILLGVFALFIYINT
    Newman          IVKPAKNNTFWPVAGFAVLLTTLTRKYIYLLNIHLEKEIVILTCCMILLGVFALFIYINT
                    ************************************************************

    COL             KLKLHIFDKNKSNNEKIILIPTFKNICLSLFAYILFGGLSTMALSMLVTSSPQNIIEFLA
    NCTC8325        KLKLHIFDKNKSNNEKIILIPTFKNICLSLFAYILFGGLSTMALSMLVTSSPQNIIEFLA
    Newman          KLKLHIFDKNKSNNEKIILIPTFKNICLSLFAYILFGGLSTMALSMLVTSSPQNIIEFLA
                    ************************************************************

    COL             LIGMTACFFLLNMSSVLDKKIHVILKTNK
    NCTC8325        LIGMTACFFLLNMSSVLDKKIHVILKTNK
    Newman          LIGMTACFFLLNMSSVLDKKIHVILKTNK
                    *****************************