From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002466000
  • symbol?:
  • description?: putative flavodoxin

      descriptions from strain specific annotations:

    • putative flavodoxin
    • NADPH-dependent FMN reductase family protein
    • putative NAD(P)H-dependent FMN-containing oxidoreductase ywqN
    • fmn reductase, NADPH-dependent
    • Trp repressor binding protein
  • strand?: +
  • coordinates?: 2982068..2982604
  • synteny block?: BlockID0017020
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0578
    08BA02176:
    C248_0685
    11819-97:
    MS7_0654 (ywqN)
    71193:
    ST398NM01_0682
    ECT-R 2:
    ECTR2_554
    ED133:
    SAOV_0636
    ED98:
    SAAV_0565
    HO 5096 0412:
    SAEMRSA15_05290
    JH1:
    SaurJH1_0639
    JH9:
    SaurJH9_0624
    JKD6008:
    SAA6008_00619
    JKD6159:
    SAA6159_00558
    LGA251:
    SARLGA251_05370
    M013:
    M013TW_0590
    MRSA252:
    SAR0609
    MSHR1132:
    SAMSHR1132_05440
    MSSA476:
    SAS0569
    Mu3:
    SAHV_0599
    Mu50:
    SAV0601
    MW2:
    MW0564
    RF122:
    SAB0553
    ST398:
    SAPIG0682
    T0131:
    SAT0131_00668
    TCH60:
    HMPREF0772_12585
    TW20:
    SATW20_06780
    USA300_TCH1516:
    USA300HOU_0607
    VC40:
    SAVC_02645

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MITVLFGGSRPNGNTAQLTKFALQDLEYQWIDVTQHQFKPIRDVRHTAETITSYDDDYLP
    N315            MITVLFGGSRPNGNTAQLTKFALQDLEYQWIDVTQHQFKPIRDVRHTAETITSYDDDYLP
    NCTC8325        MITVLFGGSRPNGNTAQLTKFALQDLEYQWIDVTQHQFKPIRDVRHTAETITSYDDDYLP
    Newman          MITVLFGGSRPNGNTAQLTKFALQDLEYQWIDVTQHQFKPIRDVRHTAETITSYDDDYLP
    USA300_FPR3757  MITVLFGGSRPNGNTAQLTKFALQDLEYQWIDVTQHQFKPIRDVRHTAETITSYDDDYLP
                    ************************************************************

    COL             ILDKILASDTIIFASPVYWYSISAPLKAFIEHWSETLQDKRYPNFKAQMAEKDFRVILVG
    N315            ILDKILASDTIIFASPVYWYSISAPLKAFIEHWSETLQDKRYPNFKAQMAEKDFRVILVG
    NCTC8325        ILDKILASDTIIFASPVYWYSISAPLKAFIEHWSETLQDKRYPNFKAQMAEKDFRVILVG
    Newman          ILDKILASDTIIFASPVYWYSISAPLKAFIEHWSETLQDKRYPNFKAQMAEKDFRVILVG
    USA300_FPR3757  ILDKILASDTIIFASPVYWYSISAPLKAFIEHWSETLQDKRYPNFKAQMAEKDFRVILVG
                    ************************************************************

    COL             GDCPKIKAKPAITQMKYSLDFLGATLNGYIIGTAEKPGDIMKDNYALARATEWNSILQ
    N315            GDCPKIKAKPAITQMKYSLDFLGATLNGYIIGTAEKPGDIMKDNYALARATEWNSILQ
    NCTC8325        GDCPKIKAKPAITQMKYSLDFLGATLNGYIIGTAEKPGDIMKDNYALARATEWNSILQ
    Newman          GDCPKIKAKPAITQMKYSLDFLGATLNGYIIGTAEKPGDIMKDNYALARATEWNSILQ
    USA300_FPR3757  GDCPKIKAKPAITQMKYSLDFLGATLNGYIIGTAEKPGDIMKDNYALARATEWNSILQ
                    **********************************************************