From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002467000
  • symbol?:
  • description?: N-acetyltransferase GCN5

      descriptions from strain specific annotations:

    • N-acetyltransferase GCN5
    • acetyltransferase (GNAT) family protein
    • acetyltransferase family protein
    • pseudogene
    • acetyltransferase, GNAT family protein
    • acetytransferase
    • putative acetyltransferase
    • GNAT family acetyltransferase
    • acetyltransferase, gnat family
  • strand?: +
  • coordinates?: 2982775..2983251
  • synteny block?: BlockID0017030
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0579
    08BA02176:
    C248_0686
    11819-97:
    MS7_0655
    71193:
    ST398NM01_0683
    ECT-R 2:
    ECTR2_555
    ED133:
    SAOV_0637
    ED98:
    SAAV_0566
    HO 5096 0412:
    SAEMRSA15_05300
    JH1:
    SaurJH1_0640
    JH9:
    SaurJH9_0625
    JKD6008:
    SAA6008_00620
    JKD6159:
    SAA6159_00559
    LGA251:
    SARLGA251_05380
    M013:
    M013TW_0591
    MRSA252:
    SAR0610
    MSHR1132:
    SAMSHR1132_05450
    MSSA476:
    SAS0570
    Mu3:
    SAHV_0600
    Mu50:
    SAV0602
    MW2:
    MW0565
    RF122:
    SAB0554
    ST398:
    SAPIG0683
    T0131:
    SAT0131_00669
    TCH60:
    HMPREF0772_12584
    TW20:
    SATW20_06790
    USA300_TCH1516:
    USA300HOU_0608
    VC40:
    SAVC_02650

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    N315            MFKVRQATEKDVVQIRDVATKAWFNTYLNIYAATTVNHLLEASYNEHHLKKRLQEQLFLV
    NCTC8325        MFKVRQATEKDVVQIRDVATKAWFNTYLNIYAATTVNHLLEASYNEHHLKKRLQEQLFLV
    Newman          MFKVRQATEKDVVQIRDVATKAWFNTYLNIYAATTVNHLLEASYNEHHLKKRLQEQLFLV
    USA300_FPR3757  MFKVRQATEKDVVQIRDVATKAWFNTYLNIYAATTVNHLLEASYNEHHLKKRLQEQLFLV
                    ************************************************************

    N315            VEEGNDIVGFANFIYGEELYLSAHYVKPESQHTGYGTALLNEGLSRFEDKFEGVYLEVDN
    NCTC8325        VEEGNDIVGFANFIYGEELYLSAHYVKPESQHTGYGTALLNEGLSRFEDKFEGVYLEVDN
    Newman          VEEGNDIVGFANFIYGEELYLSAHYVKPESQHTGYGTALLNEGLSRFEDKFEGVYLEVDN
    USA300_FPR3757  VEEGNDIVGFANFIYGEELYLSAHYVKPESQHTGYGTALLNEGLSRFEDKFEGVYLEVDN
                    ************************************************************

    N315            KNEEAVAYYKEQGFTILRSYQPEMYGEKLDLALMYKAF
    NCTC8325        KNEEAVAYYKEQGFTILRSYEPEMYGEKLDLALMYKAF
    Newman          KNEEAVAYYKEQGFTILRSYEPEMYGEKLDLALMYKAF
    USA300_FPR3757  KNEEAVAYYKEQGFTILRSYEPEMYGEKLDLALMYKAF
                    ********************:*****************