From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002468000
  • symbol?:
  • description?: HD domain-containing protein

      descriptions from strain specific annotations:

    • HD domain-containing protein
    • Deoxyguanosinetriphosphate triphosphohydrolase
    • metal dependent phosphohydrolase
    • dGTP triphosphohydrolase
    • HD domain protein
    • Phosphohydrolase
    • putative phosphohydrolase
  • strand?: +
  • coordinates?: 2983291..2984586
  • synteny block?: BlockID0017040
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0580
    08BA02176:
    C248_0687
    11819-97:
    MS7_0656
    71193:
    ST398NM01_0684
    ECT-R 2:
    ECTR2_556
    ED133:
    SAOV_0638
    ED98:
    SAAV_0567
    HO 5096 0412:
    SAEMRSA15_05310
    JH1:
    SaurJH1_0641
    JH9:
    SaurJH9_0626
    JKD6008:
    SAA6008_00621
    JKD6159:
    SAA6159_00560
    LGA251:
    SARLGA251_05390
    M013:
    M013TW_0592
    MRSA252:
    SAR0611
    MSHR1132:
    SAMSHR1132_05460
    MSSA476:
    SAS0571
    Mu3:
    SAHV_0601
    Mu50:
    SAV0603
    MW2:
    MW0566
    RF122:
    SAB0555
    ST398:
    SAPIG0684
    T0131:
    SAT0131_00670
    TCH60:
    HMPREF0772_12583
    TW20:
    SATW20_06800
    USA300_TCH1516:
    USA300HOU_0609
    VC40:
    SAVC_02655

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTNAYVDLKLVEEKVFKDPIHRYIHVEDQLIWDLIKTKEFQRLRRIRQLGTLYLSFHTAE
    N315            MTNAYVDLKLVEEKVFKDPIHRYIHVEDQLIWDLIKTKEFQRLRRIRQLGTLYLSFHTAE
    NCTC8325        MTNAYVDLKLVEEKVFKDPIHRYIHVEDQLIWDLIKTKEFQRLRRIRQLGTLYLSFHTAE
    Newman          MTNAYVDLKLVEEKVFKDPIHRYIHVEDQLIWDLIKTKEFQRLRRIRQLGTLYLSFHTAE
    USA300_FPR3757  MTNAYVDLKLVEEKVFKDPIHRYIHVEDQLIWDLIKTKEFQRLRRIRQLGTLYLSFHTAE
                    ************************************************************

    COL             HSRFGHSLGVYEIVRRLIDESFIGHDAWDNKDRPLALCAALLHDLGHGPFSHSFEKIFNT
    N315            HSRFGHSLGVYEIVRRLIDESFIGHDAWDNKDRPLALCAALLHDLGHGPFSHSFEKIFNT
    NCTC8325        HSRFGHSLGVYEIVRRLIDESFIGHDAWDNKDRPLALCAALLHDLGHGPFSHSFEKIFNT
    Newman          HSRFGHSLGVYEIVRRLIDESFIGHDAWDNKDRPLALCAALLHDLGHGPFSHSFEKIFNT
    USA300_FPR3757  HSRFGHSLGVYEIVRRLIDESFIGHDAWDNKDRPLALCAALLHDLGHGPFSHSFEKIFNT
                    ************************************************************

    COL             DHEAYTQAIITGDTEVNAVLRKVAPEFPREVAEVINKTHHNKLVISMISSQIDADRMDYL
    N315            DHEAYTQAIITGDTEVNAVLRKVSPEFPREVAEVINKTHHNKLVISMISSQIDADRMDYL
    NCTC8325        DHEAYTQAIITGDTEVNAVLRKVAPEFPREVAEVINKTHHNKLVISMISSQIDADRMDYL
    Newman          DHEAYTQAIITGDTEVNAVLRKVAPEFPREVAEVINKTHHNKLVISMISSQIDADRMDYL
    USA300_FPR3757  DHEAYTQAIITGDTEVNAVLRKVAPEFPREVAEVINKTHHNKLVISMISSQIDADRMDYL
                    ***********************:************************************

    COL             QRDAYFTGVSYGAFDMERILRLMRPSKDEVLIKESGMHAVENFIMSRYQMYWQIYFHPVS
    N315            QRDAYFTGVSYGAFDMERILRLMRPSKDEVLIKESGMHAVENFIMSRYQMYWQIYFHPVS
    NCTC8325        QRDAYFTGVSYGAFDMERILRLMRPSKDEVLIKESGMHAVENFIMSRYQMYWQIYFHPVS
    Newman          QRDAYFTGVSYGAFDMERILRLMRPSKDEVLIKESGMHAVENFIMSRYQMYWQIYFHPVS
    USA300_FPR3757  QRDAYFTGVSYGAFDMERILRLMRPSKDEVLIKESGMHAVENFIMSRYQMYWQIYFHPVS
                    ************************************************************

    COL             RGGEVLLNNCLKRAKQLYNEGYEFKLHPHDFIPFFEETVTIEQYVELDEAVVTYYLEKWT
    N315            RGGEVLLNNCLKRAKQLYNEGYEFKLHPHDFIPFFEETVTIEQYVELDEAVVTYYLEKWT
    NCTC8325        RGGEVLLNNCLKRAKQLYNEGYEFKLHPHDFIPFFEETVTIEQYVELDEAVVTYYLEKWT
    Newman          RGGEVLLNNCLKRAKQLYNEGYEFKLHPHDFIPFFEETVTIEQYVELDEAVVTYYLEKWT
    USA300_FPR3757  RGGEVLLNNCLKRAKQLYNEGYEFKLHPHDFIPFFEETVTIEQYVELDEAVVTYYLEKWT
                    ************************************************************

    COL             KEDDAILSDLASRFINRDLFKYIPFDGSIITISELQELFEAGGINPDYYFVSEAFSDLPY
    N315            KEDDAILSDLASRFINRDLFKYIPFDGSIITISELQELFEAGGINPDYYFVSEAFSDLPY
    NCTC8325        KEDDAILSDLASRFINRDLFKYIPFDGSIITISELQELFEAGGINPDYYFVSEAFSDLPY
    Newman          KEDDAILSDLASRFINRDLFKYIPFDGSIITISELQELFEAGGINPDYYFVSEAFSDLPY
    USA300_FPR3757  KEDDAILSDLASRFINRDLFKYIPFDGSIITISELQELFEAGGINPDYYFVSEAFSDLPY
                    ************************************************************

    COL             DYDRPGSNRKPIHLLRQDGTIREISNQSLVIHSITGINRQDYKLYYPREMVAKIKDKTIR
    N315            DYDRPGSNRKPIHLLRQDGTIREISNQSLVIHSITGINRQDYKLYYPREMVAKIKDKTIR
    NCTC8325        DYDRPGSNRKPIHLLRQDGTIREISNQSLVIHSITGINRQDYKLYYPREMVAKIKDKTIR
    Newman          DYDRPGSNRKPIHLLRQDGTIREISNQSLVIHSITGINRQDYKLYYPREMVAKIKDKTIR
    USA300_FPR3757  DYDRPGSNRKPIHLLRQDGTIREISNQSLVIHSITGINRQDYKLYYPREMVAKIKDKTIR
                    ************************************************************

    COL             EAIENLINELN
    N315            EAIENLINELN
    NCTC8325        EAIENLINELN
    Newman          EAIENLINELN
    USA300_FPR3757  EAIENLINELN
                    ***********