From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002469000
  • symbol?:
  • description?: YwhD like protein
  • strand?: +
  • coordinates?: 2984599..2985135
  • synteny block?: BlockID0017050
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0581
    08BA02176:
    C248_0688
    11819-97:
    MS7_0657
    71193:
    ST398NM01_0685
    ECT-R 2:
    ECTR2_557
    ED133:
    SAOV_0639
    ED98:
    SAAV_0568
    HO 5096 0412:
    SAEMRSA15_05320
    JH1:
    SaurJH1_0642
    JH9:
    SaurJH9_0627
    JKD6008:
    SAA6008_00622
    JKD6159:
    SAA6159_00561
    LGA251:
    SARLGA251_05400
    M013:
    M013TW_0593
    MRSA252:
    SAR0612
    MSHR1132:
    SAMSHR1132_05470
    MSSA476:
    SAS0572
    Mu3:
    SAHV_0602
    Mu50:
    SAV0604
    MW2:
    MW0567
    RF122:
    SAB0556
    ST398:
    SAPIG0685
    T0131:
    SAT0131_00671
    TCH60:
    HMPREF0772_12582
    TW20:
    SATW20_06810
    USA300_TCH1516:
    VC40:
    SAVC_02660

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MEVISLSEKKGFNFNIIKNDPLDGHKGTNIGSISLDNIAPVFIDVANKEAFIDIGGMHAR
    N315            -----MSEKKGFNFNIIKNDPLDGHKGTNIGSISLDNIAPVFIDVANKEAFIDIGGMHAR
    NCTC8325        MEVISLSEKKGFNFNIIKNDPLDGHKGTNIGSISLDNIAPVFIDVANKEAFIDIGGMHAR
    Newman          MEVISLSEKKGFNFNIIKNDPLDGHKGTNIGSISLDNIAPVFIDVANKEAFIDIGGMHAR
    USA300_FPR3757  MEVISLSEKKGFNFNIIKNDPLDGHKGTNIGSISLDNIAPVFIDVANKEAFIDIGGMHAR
                         :******************************************************

    COL             AKVEKGVKWITDKAAVEGDEAKEYWLCWVTTERNEQGPYYAGLTACYLLVNKAIRRGYKS
    N315            AKVEKGVKWITDKAAVEGDEAKEYWLCWVTTERNEQGPYYAGLTACYLLVNKAIRRGYKS
    NCTC8325        AKVEKGVKWITDKAAVEGDEAKEYWLCWVTTERNEQGPYYAGLTACYLLVNKAIRRGYKS
    Newman          AKVEKGVKWITDKAAVEGDEAKEYWLCWVTTERNEQGPYYAGLTACYLLVNKAIRRGYKS
    USA300_FPR3757  AKVEKGVKWITDKAAVEGDEAKEYWLCWVTTERNEQGPYYAGLTACYLLVNKAIRRGYKS
                    ************************************************************

    COL             MPEHVNMMDKSMKHHIIIDQIGDENKAILKDFLMNHDEGMWKHSSDALHQAFN
    N315            MPEHVNMMDKSMKHHIIIDQIGDENKAILKDFLMNHDEGMWKLSSDALHQAFN
    NCTC8325        MPEHVNMMDKSMKHHIIIDQIGDENKAILKDFLMNHDEGMWKHSSDALHQAFN
    Newman          MPEHVNMMDKSMKHHIIIDQIGDENKAILKDFLMNHDEGMWKHSSDALHQAFN
    USA300_FPR3757  MPEHVNMMDKSMKHHIIIDQIGDENKAILKDFLMNHDEGMWKHSSDALHQAFN
                    ****************************************** **********