From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002472000
  • symbol?:
  • description?: domain of unknown function
  • strand?: +
  • coordinates?: 2986911..2987339
  • synteny block?: BlockID0017080
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0583
    08BA02176:
    C248_0690
    11819-97:
    MS7_0659
    71193:
    ST398NM01_0687
    ECT-R 2:
    ECTR2_559
    ED133:
    SAOV_0642
    ED98:
    SAAV_0570
    HO 5096 0412:
    SAEMRSA15_05340
    JH1:
    SaurJH1_0644
    JH9:
    SaurJH9_0629
    JKD6008:
    SAA6008_00624
    JKD6159:
    SAA6159_00563
    LGA251:
    SARLGA251_05420
    M013:
    M013TW_0595
    MRSA252:
    SAR0614
    MSHR1132:
    SAMSHR1132_05500
    MSSA476:
    SAS0574
    Mu3:
    SAHV_0604
    Mu50:
    SAV0606
    MW2:
    MW0570
    RF122:
    SAB0558
    ST398:
    SAPIG0687
    T0131:
    SAT0131_00673
    TCH60:
    HMPREF0772_12580
    TW20:
    SATW20_06830
    USA300_TCH1516:
    USA300HOU_0612
    VC40:
    SAVC_02675

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSSKLDKKVSIQTKQVLKQHNEKEKFEFTTEGTWQQRQSNFIRYVEQIEDATVNVTIKVD
    N315            MSSKLDKKVSIQTKQVLKQHNEKEKFEFTTEGTWQQRQSNFIRYVEQIEDATVNVTIKVD
    NCTC8325        ---------------MLKQHNEKEKFEFTTEGTWQQRQSNFIRYVEQIEDATVNVTIKVD
    Newman          MSSKLDKKVSIQTKQVLKQHNEKEKFEFTTEGTWQQRQSNFIRYVEQIEDATVNVTIKVD
    USA300_FPR3757  ---------------MLKQHNEKEKFEFTTEGTWQQRQSNFIRYVEQIEDATVNVTIKVD
                                   :********************************************

    COL             DDSVKLIRKGDINMNLHFVEGQTTTTFYDISAGRIPLEVKTLRILHFVSGDGGKLKIHYE
    N315            DDSVKLIRKGDINMNLHFVEGQTTTTFYDISAGRIPLEVKTLRILHFVSGDGGKLKIHYE
    NCTC8325        DDSVKLIRKGDINMNLHFVEGQTTTTFYDISAGRIPLEVKTLRILHFVSGDGGKLKIHYE
    Newman          DDSVKLIRKGDINMNLHFVEGQTTTTFYDISAGRIPLEVKTLRILHFVSGDGGKLKIHYE
    USA300_FPR3757  DDSVKLIRKGDINMNLHFVEGQTTTTFYDISAGRIPLEVKTLRILHFVSGDGGKLKIHYE
                    ************************************************************

    COL             LYQDNEKMGSYQYEINYKEIGE
    N315            LYQDNEKMGSYQYEINYKEIGE
    NCTC8325        LYQDNEKMGSYQYEINYKEIGE
    Newman          LYQDNEKMGSYQYEINYKEIGE
    USA300_FPR3757  LYQDNEKMGSYQYEINYKEIGE
                    **********************