From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002480000
  • symbol?:
  • description?: hypothetical protein
  • strand?: +
  • coordinates?: 2997912..2998424
  • synteny block?: BlockID0017160
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0590
    08BA02176:
    C248_0697
    11819-97:
    MS7_0666
    71193:
    ST398NM01_0694
    ECT-R 2:
    ECTR2_566
    ED133:
    SAOV_0649
    ED98:
    SAAV_0577
    HO 5096 0412:
    SAEMRSA15_05410
    JH1:
    SaurJH1_0651
    JH9:
    SaurJH9_0636
    JKD6008:
    SAA6008_00631
    JKD6159:
    SAA6159_00570
    LGA251:
    SARLGA251_05490
    M013:
    M013TW_0602
    MRSA252:
    SAR0622
    MSHR1132:
    SAMSHR1132_05570
    MSSA476:
    SAS0581
    Mu3:
    SAHV_0611
    Mu50:
    SAV0613
    MW2:
    MW0577
    RF122:
    SAB0566
    ST398:
    SAPIG0694
    T0131:
    SAT0131_00680
    TCH60:
    HMPREF0772_12573
    TW20:
    SATW20_06900
    USA300_TCH1516:
    USA300HOU_0619
    VC40:
    SAVC_02710

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKKLLTASIIACSVVMGVGLVNTSAEAASGNSIDTVKQLIKGDQSLENVKIGESIKDVLT
    N315            MKKLLTASIIACSVVMGVGLVNTSAEAASGNSIDTVKQLIKGDQSLENVKIGESIKDVLT
    NCTC8325        MKKLLTASIIACSVVMGVGLVNTSAEAASGNSIDTVKQLIKGDQSLENVKIGESIKDVLT
    Newman          MKKLLTASIIACSVVMGVGLVNTSAEAASGNSIDTVKQLIKGDQSLENVKIGESIKDVLT
    USA300_FPR3757  MKKLLTASIIACSVVMGVGLVNTSAEAASGNSIDTVKQLIKGDQSLENVKIGESIKDVLT
                    ************************************************************

    COL             KYKNPMYSYNEDGTEHYYEFHTKKGMLLVTTDGKKNNGKVTHISMMYNDANGPTYQAVKN
    N315            KYKNPMYSYNEDGTEHYYEFHTKKGMLLVTTDGKKNNGKVTHISMMYNDANGPTYQAVKN
    NCTC8325        KYKNPMYSYNEDGTEHYYEFHTKKGMLLVTTDGKKNNGKVTHISMMYNDANGPTYQAVKN
    Newman          KYKNPMYSYNEDGTEHYYEFHTKKGMLLVTTDGKKNNGKVTHISMMYNDANGPTYQAVKN
    USA300_FPR3757  KYKNPMYSYNEDGTEHYYEFHTKKGMLLVTTDGKKNNGKVTHISMMYNDANGPTYQAVKN
                    ************************************************************

    COL             YVGKAVTHTEYSKVAGNFGYIEKGKTTYQFASAPKDKNIKLYRIDLEK
    N315            YVGKAVTHTEYSKVAGNFGYIEKGKTTYQFASAPKDKNIKLYRIDLEK
    NCTC8325        YVGKAVTHTEYSKVAGNFGYIEKGKTTYQFASAPKDKNIKLYRIDLEK
    Newman          YVGKAVTHTEYSKVAGNFGYIEKGKTTYQFASAPKDKNIKLYRIDLEK
    USA300_FPR3757  YVGKAVTHTEYSKVAGNFGYIEKGKTTYQFASAPKDKNIKLYRIDLEK
                    ************************************************