From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002492000
  • symbol?:
  • description?: phage integrase integrase/recombinase

      descriptions from strain specific annotations:

    • phage integrase integrase/recombinase
    • phage integrase family protein
    • site-specific recombinase
    • bacteriophage integrase
    • phage integrase family integrase/recombinase
    • DNA integration/recombination/invertion protein
    • phage recombinase/integrase
    • DNA integration/recombination/inversion protein
    • integrase/recombinase, phage integrase family
  • strand?: +
  • coordinates?: 3005477..3006037
  • synteny block?: BlockID0017280
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0597
    08BA02176:
    C248_0704
    11819-97:
    MS7_0673
    71193:
    ST398NM01_0701
    ECT-R 2:
    ECTR2_573
    ED133:
    SAOV_0657
    ED98:
    SAAV_0585
    HO 5096 0412:
    SAEMRSA15_05480
    JH1:
    SaurJH1_0659
    JH9:
    SaurJH9_0644
    JKD6008:
    SAA6008_00639
    JKD6159:
    SAA6159_00577
    LGA251:
    SARLGA251_05560
    M013:
    M013TW_0609
    MRSA252:
    SAR0629
    MSHR1132:
    SAMSHR1132_05650
    MSSA476:
    SAS0588
    Mu3:
    SAHV_0618
    Mu50:
    SAV0620
    MW2:
    MW0584
    RF122:
    SAB0572
    ST398:
    SAPIG0701
    T0131:
    SAT0131_00689
    TCH60:
    HMPREF0772_12567
    TW20:
    SATW20_06970
    USA300_TCH1516:
    USA300HOU_0642
    VC40:
    SAVC_02745

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNKVEAIKFNDDIVKMYEALKIKSERDYLFFKLAIHSGLKVSELLTITVSQVKRLIEKCT
    N315            MNKVEAIKFNDDIVKMYEALKIKSERDYLFFKLAIHSGLKVSELLTITVSQVKRLIEKCT
    NCTC8325        MNKVEAIKFNDDIVKMYEALKIKSERDYLFFKLAIHSGLKVSELLTITVSQVKRLIEKCT
    Newman          MNKVEAIKFNDDIVKMYEALKIKSERDYLFFKLAIHSGLKVSELLTITVSQVKRLIEKCT
    USA300_FPR3757  MNKVEAIKFNDDIVKMYEALKIKSERDYLFFKLAIHSGLKVSELLTITVSQVKRLIEKCT
                    ************************************************************

    COL             LSEMCKAHFHSLIKIRLPETLSKELLQYIEDRSLSNEDVLFQSLRTNQVLSRQQAYRIIH
    N315            LSEMCKAHFHSLIKIRLPETLSKELLQYIEDRSLSNEDVLFQSLRTNQVLSRQQAYRIIH
    NCTC8325        LSEMCKAHFHSLIKIRLPETLSKELLQYIEDRSLSNEDVLFQSLRTNQVLSRQQAYRIIH
    Newman          LSEMCKAHFHSLIKIRLPETLSKELLQYIEDRSLSNEDVLFQSLRTNQVLSRQQAYRIIH
    USA300_FPR3757  LSEMCKAHFHSLIKIRLPETLSKELLQYIEDRSLSNEDVLFQSLRTNQVLSRQQAYRIIH
                    ************************************************************

    COL             QASIEAGIDNVGLTTLRKTFAYHAYQKGIPIPVIQKYLGHQSAIETLNFIGLENECEHSI
    N315            QASIEAGIDNVGLTTLRKTFAYHAYQKGIPIPVIQKYLGHQSAIETLNFIGLENECEHSI
    NCTC8325        QASIEAGIDNVGLTTLRKTFAYHAYQKGILIPVIQKYLGHQSAIETLNFIGLENECEHSI
    Newman          QASIEAGIDNVGLTTLRKTFAYHAYQKGIPIPVIQKYLGHQSAIETLNFIGLENECEHSI
    USA300_FPR3757  QASIEAGIDNVGLTTLRKTFAYHAYQKGIPIPVIQKYLGHQSAIETLNFIGLENECEHSI
                    ***************************** ******************************

    COL             YISLQL
    N315            YISLQL
    NCTC8325        YISLQL
    Newman          YISLQL
    USA300_FPR3757  YISLQL
                    ******