Due to technical reasons this service will not be available for 7 days from 27 Nov to 04 Dec 2017
From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002495000
  • symbol?: mnhB2
  • description?: monovalent cation/H+ antiporter subunit B

      descriptions from strain specific annotations:

    • monovalent cation/H+ antiporter subunit B
    • putative monovalent cation/H+ antiporter subunit B
    • Na(+) H(+) antiporter subunit B
    • domain related to MnhB subunit of Na+/H+ antiporter family protein
    • monovalent cation antiporter-3, MnhB_1
    • Putative antiporter subunit mnhB2
    • Na(+)/H(+) antiporter subunit B
    • CPA3 family monovalent cation (K+ or Na+):proton (H+) antiporter-3, MnhB subunit
    • Na(+)/H(+) antiporter subunit B (Multiple resistance and pHhomeostasis protein B) (Mrp complex subunit B)
    • ShaB
  • strand?: +
  • coordinates?: 3008445..3008870
  • synteny block?: BlockID0017310
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    NWMN_0594 (mnhB)
    USA300_FPR3757:
    04-02981:
    SA2981_0599
    08BA02176:
    C248_0706
    11819-97:
    MS7_0675
    71193:
    ST398NM01_0703
    ECT-R 2:
    ECTR2_575
    ED133:
    SAOV_0659
    ED98:
    SAAV_0587
    HO 5096 0412:
    SAEMRSA15_05500
    JH1:
    SaurJH1_0661
    JH9:
    SaurJH9_0646
    JKD6008:
    SAA6008_00641 (mnhB_1)
    JKD6159:
    SAA6159_00579 (mnhB_1)
    LGA251:
    SARLGA251_05580
    M013:
    M013TW_0612
    MRSA252:
    SAR0631
    MSHR1132:
    SAMSHR1132_05670
    MSSA476:
    SAS0590
    Mu3:
    SAHV_0620
    Mu50:
    SAV0623
    MW2:
    MW0586
    RF122:
    SAB0574
    ST398:
    SAPIG0703
    T0131:
    SAT0131_00691
    TCH60:
    HMPREF0772_12565 (mnhB2)
    TW20:
    SATW20_06990
    USA300_TCH1516:
    USA300HOU_0644 (mnhB1)
    VC40:
    SAVC_02755

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKENDVVLRTVTKLVVFILLTFGFYVFFAGHNNPGGGFIGGLIFSSAFILMFLAFNVEEV
    N315            MKENDVVLRTVTKLVVFILLTFGFYVFFAGHNNPGGGFIGGLIFSSAFILMFLAFNVEEV
    NCTC8325        MKENDVVLRTVTKLVVFILLTFGFYVFFAGHNNPGGGFIGGLIFSSAFILMFLAFNVEEV
    Newman          MKENDVVLRTVTKLVVFILLTFGFYVFFAGHNNPGGGFIGGLIFSSAFILMFLAFNVEEV
    USA300_FPR3757  MKENDVVLRTVTKLVVFILLTFGFYVFFAGHNNPGGGFIGGLIFSSAFILMFLAFNVEEV
                    ************************************************************

    COL             LESLPIDFRILMIIGALVSSITAIIPMFFGKPFLSQYETTWILPILGQIHVSTITLFELG
    N315            LESLPIDFRILMIIGALVSSITAIIPMFFGKPFLSQYETTWILPILGQIHVSTITLFELG
    NCTC8325        LESLPIDFRILMIIGALVSSITAIIPMFFGKPFLSQYETTWILPILGQIHVSTITLFELG
    Newman          LESLPIDFRILMIIGALVSSITAIIPMFFGKPFLSQYETTWILPILGQIHVSTITLFELG
    USA300_FPR3757  LESLPIDFRILMIIGALVSSITAIIPMFFGKPFLSQYETTWILPILGQIHVSTITLFELG
                    ************************************************************

    COL             ILFSVVGVIVTVMLSLSGGRS
    N315            ILFSVVGVIVTVMLSLSGGRS
    NCTC8325        ILFSVVGVIVTVMLSLSGGRS
    Newman          ILFSVVGVIVTVMLSLSGGRS
    USA300_FPR3757  ILFSVVGVIVTVMLSLSGGRS
                    *********************