From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002496000
  • symbol?: mnhC2
  • description?: monovalent cation/H+ antiporter subunit C

      descriptions from strain specific annotations:

    • monovalent cation/H+ antiporter subunit C
    • putative monovalent cation/H+ antiporter subunit C
    • Na(+) H(+) antiporter subunit C
    • NADH-ubiquinone/plastoquinone oxidoreductase chain 4L family protein
    • monovalent cation antiporter-3, MnhC_1
    • Putative antiporter subunit mnhC2
    • Na(+)/H(+) antiporter subunit C
    • CPA3 family monovalent cation (K+ or Na+):proton (H+) antiporter-3 MnhC subunit
    • Na(+)/H(+) antiporter subunit C (Multiple resistance and pHhomeostasis protein C) (Mrp complex subunit C)
    • ShaC
  • strand?: +
  • coordinates?: 3008867..3009211
  • synteny block?: BlockID0017320
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    NWMN_0595 (mnhC)
    USA300_FPR3757:
    04-02981:
    SA2981_0600
    08BA02176:
    C248_0707
    11819-97:
    MS7_0676
    71193:
    ST398NM01_0704
    ECT-R 2:
    ECTR2_576
    ED133:
    SAOV_0660
    ED98:
    SAAV_0588
    HO 5096 0412:
    SAEMRSA15_05510
    JH1:
    SaurJH1_0662
    JH9:
    SaurJH9_0647
    JKD6008:
    SAA6008_00642 (mnhC_1)
    JKD6159:
    SAA6159_00580 (mnhC_1)
    LGA251:
    SARLGA251_05590
    M013:
    M013TW_0613
    MRSA252:
    SAR0632
    MSHR1132:
    SAMSHR1132_05680
    MSSA476:
    SAS0591
    Mu3:
    SAHV_0621
    Mu50:
    SAV0624
    MW2:
    MW0587
    RF122:
    SAB0575
    ST398:
    SAPIG0704
    T0131:
    SAT0131_00692 (dinP)
    TCH60:
    HMPREF0772_12564 (mnhC2)
    TW20:
    SATW20_07000
    USA300_TCH1516:
    USA300HOU_0645 (mnhC1)
    VC40:
    SAVC_02760

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNLILLLVIGFLVFIGTYMILSINLIRIVIGISIYTHAGNLIIMSMGTYGSSRSEPLITG
    N315            MNLILLLVIGFLVFIGTYMILSINLIRIVIGISIYTHAGNLIIMSMGTYGSSRSEPLITG
    NCTC8325        MNLILLLVIGFLVFIGTYMILSINLIRIVIGISIYTHAGNLIIMSMGTYGSSRSEPLITG
    Newman          MNLILLLVIGFLVFIGTYMILSINLIRIVIGISIYTHAGNLIIMSMGTYGSSRSEPLITG
    USA300_FPR3757  MNLILLLVIGFLVFIGTYMILSINLIRIVIGISIYTHAGNLIIMSMGTYGSSRSEPLITG
                    ************************************************************

    COL             GNQLFVDPLLQAIVLTAIVIGFGMTAFLLVLVYRTYKVTKEDEIEGLRGEDDAK
    N315            GNQLFVDPLLQAIVLTAIVIGFGMTAFLLVLVYRTYKVTKEDEIEGLRGEDDAK
    NCTC8325        GNQLFVDPLLQAIVLTAIVIGFGMTAFLLVLVYRTYKVTKEDEIEGLRGEDDAK
    Newman          GNQLFVDPLLQAIVLTAIVIGFGMTAFLLVLVYRTYKVTKEDEIEGLRGEDDAK
    USA300_FPR3757  GNQLFVDPLLQAIVLTAIVIGFGMTAFLLVLVYRTYKVTKEDEIEGLRGEDDAK
                    ******************************************************