From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002500000
  • symbol?: mnhF2
  • description?: monovalent cation/H+ antiporter subunit F

      descriptions from strain specific annotations:

    • monovalent cation/H+ antiporter subunit F
    • putative monovalent cation/H+ antiporter subunit F
    • monovalent cation antiporter-3, MnhF_1
    • Na(+) H(+) antiporter subunit F
    • multiple resistance and pH regulation protein F (MrpF / PhaF) family protein
    • Putative antiporter subunit mnhF2
    • multiple resistance and pH regulation F family protein
    • CPA3 family monovalent cation (K+ or Na+):proton (H+) antiporter-3, MnhF subunit
    • multisubunit Na+/H+ antiporter, MnhF subunit
    • ShaF
  • strand?: +
  • coordinates?: 3011177..3011479
  • synteny block?: BlockID0017360
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    NWMN_0598 (mnhF)
    USA300_FPR3757:
    04-02981:
    SA2981_0603
    08BA02176:
    C248_0710
    11819-97:
    MS7_0679
    71193:
    ST398NM01_0707
    ECT-R 2:
    ECTR2_579
    ED133:
    SAOV_0663
    ED98:
    SAAV_0591
    HO 5096 0412:
    SAEMRSA15_05540
    JH1:
    SaurJH1_0665
    JH9:
    SaurJH9_0650
    JKD6008:
    SAA6008_00645 (mnhF_1)
    JKD6159:
    SAA6159_00583 (mnhF_1)
    LGA251:
    SARLGA251_05620
    M013:
    M013TW_0616
    MRSA252:
    SAR0635
    MSHR1132:
    SAMSHR1132_05710
    MSSA476:
    SAS0594
    Mu3:
    SAHV_0624
    Mu50:
    SAV0627
    MW2:
    MW0590
    RF122:
    SAB0578
    ST398:
    SAPIG0707
    T0131:
    SAT0131_00696
    TCH60:
    HMPREF0772_12561 (mnhF2)
    TW20:
    SATW20_07030
    USA300_TCH1516:
    USA300HOU_0648 (mnhF1)
    VC40:
    SAVC_02775

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MIQTITHIMIISSLIIFGIALIICLFRLIKGPTTADRVVTFDTTSAVVMSIVGVLSVLMG
    N315            MIQTITHIMIISSLIIFGIALIICLFRLIKGPTTADRVVTFDTTSAVVMSIVGVLSVLMG
    NCTC8325        MIQTITHIMIISSLIIFGIALIICLFRLIKGPTTADRVVTFDTTSAVVMSIVGVLSVLMG
    Newman          MIQTITHIMIISSLIIFGIALIICLFRLIKGPTTADRVVTFDTTSAVVMSIVGVLSVLMG
    USA300_FPR3757  MIQTITHIMIISSLIIFGIALIICLFRLIKGPTTADRVVTFDTTSAVVMSIVGVLSVLMG
                    ************************************************************

    COL             TVSFLDSIMLIAIISFVSSVSISRFIGGGHVFNGNNKRNL
    N315            TVSFLDSIMLIAIISFVSSVSISRFIGGGHVFNGNNKRNL
    NCTC8325        TVSFLDSIMLIAIISFVSSVSISRFIGGGHVFNGNNKRNL
    Newman          TVSFLDSIMLIAIISFVSSVSISRFIGGGHVFNGNNKRNL
    USA300_FPR3757  TVSFLDSIMLIAIISFVSSVSISRFIGGGHVFNGNNKRNL
                    ****************************************