From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002501000
  • symbol?: mnhG2
  • description?: monovalent cation/H+ antiporter subunit G

      descriptions from strain specific annotations:

    • monovalent cation/H+ antiporter subunit G
    • putative monovalent cation/H+ antiporter subunit G
    • Na(+) H(+) antiporter subunit G
    • monovalent cation/proton antiporter subunit MnhG/PhaG
    • Na+/H+ antiporter subunit
    • monovalent cation antiporter-3, MnhG_1
    • Putative antiporter subunit mnhG2
    • pseudogene
    • CPA3 family monovalent cation (K+ or Na+):proton (H+) antiporter-3, MnhG subunit
    • MrpG
    • ShaG
  • strand?: +
  • coordinates?: 3011433..3011891
  • synteny block?: BlockID0017370
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    NWMN_0599 (mnhG)
    USA300_FPR3757:
    04-02981:
    SA2981_0604
    08BA02176:
    C248_0711
    11819-97:
    MS7_0680
    71193:
    ST398NM01_0708
    ECT-R 2:
    ECTR2_580
    ED133:
    SAOV_0664
    ED98:
    SAAV_0592
    HO 5096 0412:
    SAEMRSA15_05550
    JH1:
    SaurJH1_0666
    JH9:
    SaurJH9_0651
    JKD6008:
    SAA6008_00646 (mnhG_1)
    JKD6159:
    SAA6159_00584 (mnhG_1)
    LGA251:
    SARLGA251_05630
    M013:
    M013TW_0617
    MRSA252:
    SAR0636
    MSHR1132:
    SAMSHR1132_05720
    MSSA476:
    SAS0595
    Mu3:
    SAHV_0625
    Mu50:
    SAV0628
    MW2:
    MW0591
    RF122:
    SAB0579
    ST398:
    SAPIG0708
    T0131:
    SAT0131_00697
    TCH60:
    HMPREF0772_12560 (mnhG2)
    TW20:
    SATW20_07040
    USA300_TCH1516:
    USA300HOU_0649 (mnhG1)
    VC40:
    SAVC_02780

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             -------MEITKEIFSLIAAVMLLLGSFIALISAIGIVKFQDVFLRSHAATKSSTLSVLL
    N315            -------MEITKEIFSLIAAVMLLLGSFIALISAIGIVKFQDVFLRSHAATKSSTLSVLL
    NCTC8325        MVGGMCLMEITKEIFSLIAAVMLLLGSFIALISAIGIVKFQDVFLRSHAATKSSTLSVLL
    Newman          ----MCLMEITKEIFSLIAAVMLLLGSFIALISAIGIVKFQDVFLRSHAATKSSTLSVLL
    USA300_FPR3757  -------MEITKEIFSLIAAVMLLLGSFIALISAIGIVKFQDVFLRSHAATKSSTLSVLL
                           *****************************************************

    COL             TLIGVLIYFIVNTGFFSVRLLLSLVFINLTSPVGMHLVARAAYRNGAYMYRKNDAHTHAS
    N315            TLIGVLIYFIVNTGFFSVRLLLSLVFINLTSPVGMHLVARAAYRNGAYMYRKNDAHTHAS
    NCTC8325        TLIGVLIYFIVNTGFFSVRLLLSLVFINLTSPVGMHLVARAAYRNGAYMYRKNDAHTHAS
    Newman          TLIGVLIYFIVNTGFFSVRLLLSLVFINLTSPVGMHLVARAAYRNGAYMYRKNDAHTHAS
    USA300_FPR3757  TLIGVLIYFIVNTGFFSVRLLLSLVFINLTSPVGMHLVARAAYRNGAYMYRKNDAHTHAS
                    ************************************************************

    COL             ILLSSNEQNSTEALQLRAEKREEHRKKWYQND
    N315            ILLSSNEQNSTEALQLRAKKREEHRKKWYQND
    NCTC8325        ILLSSNEQNSTEALQLRAEKREEHRKKWYQND
    Newman          ILLSSNEQNSTEALQLRAEKREEHRKKWYQND
    USA300_FPR3757  ILLSSNEQNSTEALQLRAEKREEHRKKWYQND
                    ******************:*************