From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002509000
  • symbol?: mntA
  • description?: ABC transporter ATP-binding protein

      descriptions from strain specific annotations:

    • ABC transporter ATP-binding protein
    • Manganese ABC transporter, ATP-binding protein
    • Manganese ABC transporter, ATP-binding protein SitB
    • ABC superfamily ATP binding cassette transporter, ABC protein
    • manganese transport system ATP-binding protein
    • ABC transporter-like protein
    • cation ATP-binding ABC transporter
    • ABC transporter family protein
  • strand?: -
  • coordinates?: 3022451..3023194
  • synteny block?: BlockID0017450
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0609 (sitB)
    08BA02176:
    C248_0715
    11819-97:
    MS7_0684
    71193:
    ST398NM01_0712
    ECT-R 2:
    ECTR2_585
    ED133:
    SAOV_0668c
    ED98:
    SAAV_0596
    HO 5096 0412:
    SAEMRSA15_05590
    JH1:
    SaurJH1_0671
    JH9:
    SaurJH9_0656
    JKD6008:
    SAA6008_00650 (mntA)
    JKD6159:
    SAA6159_00588 (mntA)
    LGA251:
    SARLGA251_05670 (mntA)
    M013:
    M013TW_0621
    MRSA252:
    SAR0643
    MSHR1132:
    SAMSHR1132_05790
    MSSA476:
    SAS0599
    Mu3:
    SAHV_0630
    Mu50:
    SAV0633
    MW2:
    MW0595
    RF122:
    SAB0583c (mntA)
    ST398:
    SAPIG0712
    T0131:
    SAT0131_00702
    TCH60:
    HMPREF0772_12554
    TW20:
    SATW20_07080 (mntA)
    USA300_TCH1516:
    USA300HOU_0653
    VC40:
    SAVC_02800

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MLETKDLNLFLGNKHVLKNISLSIPVRGEIIGIMGPNGAGKSSLIKSLIGEFNATGTKLL
    N315            MLETKDLNLFLGNKHVLKNISLSIPVRGEIIGIMGPNGAGKSSLIKSLIGEFNATGTKLL
    NCTC8325        MLETKDLNLFLGNKHVLKNISLSIPVRGEIIGIMGPNGAGKSSLIKSLIGEFNATGTKLL
    Newman          MLETKDLNLFLGNKHVLKNISLSIPVRGEIIGIMGPNGAGKSSLIKSLIGEFNATGTKLL
    USA300_FPR3757  MLETKDLNLFLGNKHVLKNISLSIPVRGEIIGIMGPNGAGKSSLIKSLIGEFNATGTKLL
                    ************************************************************

    COL             YNKPIQQQLQHITYIPQKAHIDLDFPISVEQVILSGCYKEIGWFRRPNKSARDKLKQLLS
    N315            YNKPIQQQLQHITYIPQKAHIDLDFPISVEQVILSGCYKEIGWFRRPNKSARDKLKQLLS
    NCTC8325        YNKPIQQQLQHITYIPQKAHIDLDFPISVEQVILSGCYKEIGWFRRPNKSARDKLKQLLS
    Newman          YNKPIQQQLQHITYIPQKAHIDLDFPISVEQVILSGCYKEIGWFRRPNKSARDKLKQLLS
    USA300_FPR3757  YNKPIQQQLQHITYIPQKAHIDLDFPISVEQVILSGCYKEIGWFRRPNKSARDKLKQLLS
                    ************************************************************

    COL             DLELESLRHRQISELSGGQLQRVLVARALMSESEVYFLDEPFVGIDFSSEKLIMTKIENL
    N315            DLELESLRHRQISELSGGQLQRVLVARALMSESEVYFLDEPFVGIDFSSEKLIMTKIENL
    NCTC8325        DLELESLRHRQISELSGGQLQRVLVARALMSESEVYFLDEPFVGIDFSSEKLIMTKIENL
    Newman          DLELESLRHRQISELSGGQLQRVLVARALMSESEVYFLDEPFVGIDFSSEKLIMTKIENL
    USA300_FPR3757  DLELESLRHRQISELSGGQLQRVLVARALMSESEVYFLDEPFVGIDFSSEKLIMTKIENL
                    ************************************************************

    COL             KQQGKLILIIHHDLSKAKQYFDRIILLNQTLRYFGDSEEAMSVTRLNETFMSSTDCSDPS
    N315            KQQGKLILIIHHDLSKAKQYFDRIILLNQTLRYFGDSEEAMSVTRLNETFMSSTDCSDPS
    NCTC8325        KQQGKLILIIHHDLSKAKQYFDRIILLNQTLRYFGDSEEAMSVTRLNETFMSSTDCSDPS
    Newman          KQQGKLILIIHHDLSKAKQYFDRIILLNQTLRYFGDSEEAMSVTRLNETFMSSTDCSDPS
    USA300_FPR3757  KQQGKLILIIHHDLSKAKQYFDRIILLNQTLRYFGDSEEAMSVTRLNETFMSSTDCSDPS
                    ************************************************************

    COL             QRSNITC
    N315            QRSNITC
    NCTC8325        QRSNITC
    Newman          QRSNITC
    USA300_FPR3757  QRSNITC
                    *******