From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002513000
  • symbol?: tagH
  • description?: teichoic acids export protein ATP-binding subunit

      descriptions from strain specific annotations:

    • teichoic acids export protein ATP-binding subunit
    • Teichoic acid export ATP-binding protein TagH
    • O-antigen export system ATP-binding protein rfbB
    • teichoic acids export ATP-binding protein TagH
    • teichoic acid ABC transporter ATP-bindingprotein
    • Teichoic acid export ATP-binding protein, TagH
    • teichoic acids ABC superfamily ATP binding cassette transporter, ABC protein
    • teichoic acids export ATP-binding protein TagH (Teichoicacid-transporting ATPase)
    • teichoic acid ABC transporter protein, putative
  • strand?: -
  • coordinates?: 3025859..3026653
  • synteny block?: BlockID0017490
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    SA0593 (tagH)
    NCTC8325:
    Newman:
    NWMN_0607 (tagH)
    USA300_FPR3757:
    04-02981:
    SA2981_0613 (tagH)
    08BA02176:
    C248_0719 (tagH)
    11819-97:
    MS7_0688 (tagH)
    71193:
    ST398NM01_0716
    ECT-R 2:
    ECTR2_589
    ED133:
    SAOV_0672c
    ED98:
    SAAV_0600
    HO 5096 0412:
    SAEMRSA15_05630 (tagH)
    JH1:
    SaurJH1_0675
    JH9:
    SaurJH9_0660
    JKD6008:
    SAA6008_00654 (tagH)
    JKD6159:
    SAA6159_00592 (tagH)
    LGA251:
    SARLGA251_05710 (tagH)
    M013:
    M013TW_0625
    MRSA252:
    SAR0647 (tagH)
    MSHR1132:
    SAMSHR1132_05830
    MSSA476:
    SAS0603
    Mu3:
    SAHV_0634 (tagH)
    Mu50:
    SAV0637 (tagH)
    MW2:
    MW0599 (tagH)
    RF122:
    SAB0587c (tagH)
    ST398:
    SAPIG0716
    T0131:
    SAT0131_00706 (pfl)
    TCH60:
    HMPREF0772_12550 (rfbB)
    TW20:
    SATW20_07120 (tagH)
    USA300_TCH1516:
    USA300HOU_0657 (tagH)
    VC40:
    SAVC_02820

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNVSVNIKNVTKEYRIYRTNKERMKDALIPKHKNKTFFALDDISLKAYEGDVIGLVGING
    N315            MNVSVNIKNVTKEYRIYRTNKERMKDALIPKHKNKTFFALDDISLKAYEGDVIGLVGING
    NCTC8325        MNVSVNIKNVTKEYRIYRTNKERMKDALIPKHKNKTFFALDDISLKAYEGDVIGLVGING
    Newman          MNVSVNIKNVTKEYRIYRTNKERMKDALIPKHKNKTFFALDDISLKAYEGDVIGLVGING
    USA300_FPR3757  MNVSVNIKNVTKEYRIYRTNKERMKDALIPKHKNKTFFALDDISLKAYEGDVIGLVGING
                    ************************************************************

    COL             SGKSTLSNIIGGSLSPTVGKVDRNGEVSVIAISAGLSGQLTGIENIEFKMLCMGFKRKEI
    N315            SGKSTLSNIIGGSLSPTVGKVDRNGEVSVIAISAGLSGQLTGIENIEFKMLCMGFKRKEI
    NCTC8325        SGKSTLSNIIGGSLSPTVGKVDRNGEVSVIAISAGLSGQLTGIENIEFKMLCMGFKRKEI
    Newman          SGKSTLSNIIGGSLSPTVGKVDRNGEVSVIAISAGLSGQLTGIENIEFKMLCMGFKRKEI
    USA300_FPR3757  SGKSTLSNIIGGSLSPTVGKVDRNGEVSVIAISAGLSGQLTGIENIEFKMLCMGFKRKEI
                    ************************************************************

    COL             KAMTPKIIEFSELGEFIYQPVKKYSSGMRAKLGFSINITVNPDILVIDEALSVGDQTFAQ
    N315            KAMTPKIIEFSELGEFIYQPVKKYSSGMRAKLGFSINITVNPDILVIDEALSVGDQTFAQ
    NCTC8325        KAMTPKIIEFSELGEFIYQPVKKYSSGMRAKLGFSINITVNPDILVIDEALSVGDQTFAQ
    Newman          KAMTPKIIEFSELGEFIYQPVKKYSSGMRAKLGFSINITVNPDILVIDEALSVGDQTFAQ
    USA300_FPR3757  KAMTPKIIEFSELGEFIYQPVKKYSSGMRAKLGFSINITVNPDILVIDEALSVGDQTFAQ
                    ************************************************************

    COL             KCLDKIYEFKEQNKTIFFVSHNLGQVRQFCTKIAWIEGGKLKDYGELDDVLPKYEAFLND
    N315            KCLDKIYEFKEQNKTIFFVSHNLGQVRQFCTKIAWIEGGKLKDYGELDDVLPKYEAFLND
    NCTC8325        KCLDKIYEFKEQNKTIFFVSHNLGQVRQFCTKIAWIEGGKLKDYGELDDVLPKYEAFLND
    Newman          KCLDKIYEFKEQNKTIFFVSHNLGQVRQFCTKIAWIEGGKLKDYGELDDVLPKYEAFLND
    USA300_FPR3757  KCLDKIYEFKEQNKTIFFVSHNLGQVRQFCTKIAWIEGGKLKDYGELDDVLPKYEAFLND
                    ************************************************************

    COL             FKKKSKAEQKEFRNKLDESRFVIK
    N315            FKKKSKAEQKEFRNKLDEARFVIK
    NCTC8325        FKKKSKAEQKEFRNKLDESRFVIK
    Newman          FKKKSKAEQKEFRNKLDESRFVIK
    USA300_FPR3757  FKKKSKAEQKEFRNKLDESRFVIK
                    ******************:*****