From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002514000
  • symbol?: tagG
  • description?: teichoic acid ABC transporter permease

      descriptions from strain specific annotations:

    • teichoic acid ABC transporter permease
    • tagG protein, teichoic acid ABC transporter protein
    • teichoic acid translocation permease
    • teichoic acid biosynthesis protein
    • teichoic acid ABC transporter protein
    • Teichoic acid translocation permease protein TagG
    • tagG protein, teichoic acid ABC transporter protein, putative
    • teichoic acid ABC superfamily ATP binding cassette transporter, membrane protein
    • teichoic acid ABC transporter ATP-binding/membrane protein
    • teichoic acid ABC transporter permease protein
    • teichoic acids ABC superfamily ATP binding cassette transporter, permease protein
    • teichoic acid translocation permease protein
  • strand?: +
  • coordinates?: 3026910..3027812
  • synteny block?: BlockID0017500
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    SA0594 (tagG)
    NCTC8325:
    Newman:
    NWMN_0608 (tagG)
    USA300_FPR3757:
    04-02981:
    SA2981_0614 (tagG)
    08BA02176:
    C248_0720 (tagG)
    11819-97:
    MS7_0689
    71193:
    ST398NM01_0717
    ECT-R 2:
    ECTR2_590
    ED133:
    SAOV_0673
    ED98:
    SAAV_0601
    HO 5096 0412:
    SAEMRSA15_05640 (tagG)
    JH1:
    SaurJH1_0676
    JH9:
    SaurJH9_0661
    JKD6008:
    SAA6008_00655 (tagG)
    JKD6159:
    SAA6159_00593 (tagG)
    LGA251:
    SARLGA251_05720 (tagG)
    M013:
    M013TW_0626
    MRSA252:
    SAR0648 (tagG)
    MSHR1132:
    SAMSHR1132_05840
    MSSA476:
    SAS0604
    Mu3:
    SAHV_0635 (tagG)
    Mu50:
    SAV0638 (tagG)
    MW2:
    MW0600 (tagG)
    RF122:
    SAB0588 (tagG)
    ST398:
    SAPIG0717
    T0131:
    SAT0131_00707 (putP)
    TCH60:
    HMPREF0772_12549 (tagG2)
    TW20:
    SATW20_07130 (tagG)
    USA300_TCH1516:
    USA300HOU_0658 (tagG)
    VC40:
    SAVC_02825

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             -------MSAIGTVFKEHVKNFYLIQRLAQFQVKIINHSNYLGVAWELINPVMQIMVYWM
    N315            MKVWFNGMSAIGTVFKEHVKNFYLIQRLAQFQVKIINHSNYLGVAWELINPVMQIMVYWM
    NCTC8325        -------MSAIGTVFKEHVKNFYLIQRLAQFQVKIINHSNYLGVAWELINPVMQIMVYWM
    Newman          MKVWFNGMSAIGTVFKEHVKNFYLIQRLAQFQVKIINHSNYLGVAWELINPVMQIMVYWM
    USA300_FPR3757  -------MSAIGTVFKEHVKNFYLIQRLAQFQVKIINHSNYLGVAWELINPVMQIMVYWM
                           *****************************************************

    COL             VFGLGIRSNAPIHGVPFVYWLLVGISMWFFINQGILEGTKAITQKFNQVSKMNFPLSIIP
    N315            VFGLGIRSNAPIHGVPFVYWLLVGISMWFFINQGILEGTKAITQKFNQVSKMNFPLSIIP
    NCTC8325        VFGLGIRSNAPIHGVPFVYWLLVGISMWFFINQGILEGTKAITQKFNQVSKMNFPLSIIP
    Newman          VFGLGIRSNAPIHGVPFVYWLLVGISMWFFINQGILEGTKAITQKFNQVSKMNFPLSIIP
    USA300_FPR3757  VFGLGIRSNAPIHGVPFVYWLLVGISMWFFINQGILEGTKAITQKFNQVSKMNFPLSIIP
                    ************************************************************

    COL             TYIVTSRFYGHLGLLLLVIIACMFTGIYPSIHIIQLLIYVPFCFFLTASVTLLTSTLGVL
    N315            TYIVTSRFYGHLGLLLLVIIACMFTGIYPSIHIIQLLIYVPFCFFLTASVTLLTSTLGVL
    NCTC8325        TYIVTSRFYGHLGLLLLVIIACMFTGIYPSIHIIQLLIYVPFCFFLTASVTLLTSTLGVL
    Newman          TYIVTSRFYGHLGLLLLVIIACMFTGIYPSIHIIQLLIYVPFCFFLTASVTLLTSTLGVL
    USA300_FPR3757  TYIVTSRFYGHLGLLLLVIIACMFTGIYPSIHIIQLLIYVPFCFFLTASVTLLTSTLGVL
                    ************************************************************

    COL             VRDTQMLMQAILRILFYFSPILWLPKNHGISGLIHEMMKYNPVYFIAESYRAAILYHEWY
    N315            VRDTQMLMQAILRILFYFSPILWLPKNHGISGLIHEMMKYNPVYFIVESYRAAILYHEWY
    NCTC8325        VRDTQMLMQAILRILFYFSPILWLPKNHGISGLIHEMMKYNPVYFIAESYRAAILYHEWY
    Newman          VRDTQMLMQAILRILFYFSPILWLPKNHGISGLIHEMMKYNPVYFIAESYRAAILYHEWY
    USA300_FPR3757  VRDTQMLMQAILRILFYFSPILWLPKNHGISGLIHEMMKYNPVYFIAESYRAAILYHEWY
                    **********************************************.*************

    COL             FMDHWKLMLYNFGIVAIFFAIGAYLHMKYRDQFADFL
    N315            FMDHWKLMLYNFGIVAIFFAIGAYLHMKYRDQFADFL
    NCTC8325        FMDHWKLMLYNFGIVAIFFAIGAYLHMKYRDQFADFL
    Newman          FMDHWKLMLYNFGIVAIFFAIGAYLHMKYRDQFADFL
    USA300_FPR3757  FMDHWKLMLYNFGIVAIFFAIGAYLHMKYRDQFADFL
                    *************************************