From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002520000
  • symbol?: abcA
  • description?: ABC transporter ATP-binding protein

      descriptions from strain specific annotations:

    • ABC transporter ATP-binding protein
    • ABC transporter ATP-binding protein/permease
    • ATP-binding cassette transporter A
    • ABC superfamily ATP binding cassette transporter, ABC protein
    • ABC transporter
    • ABC transporter-like protein
    • Lipid A export ATP-binding/permease MsbA
    • Lipid A export ATP-binding/permease protein MsbA
    • multidrug resistance ABC transporter ATP-binding/permease protein BmrA
    • multidrug resistance ABC transporter ATP-binding and permease
    • multidrug resistance ABC transporter ATP-binding and permease protein
  • strand?: +
  • coordinates?: 3032911..3034638
  • synteny block?: BlockID0017560
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0700 (abcA)
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0619 (msbA)
    08BA02176:
    C248_0725
    11819-97:
    MS7_0694 (bmrA)
    71193:
    ST398NM01_0722
    ECT-R 2:
    ECTR2_595
    ED133:
    SAOV_0678 (abcA)
    ED98:
    SAAV_0606 (abcA)
    HO 5096 0412:
    SAEMRSA15_05690
    JH1:
    SaurJH1_0681
    JH9:
    SaurJH9_0666
    JKD6008:
    SAA6008_00660 (abcA)
    JKD6159:
    SAA6159_00598 (abcA)
    LGA251:
    SARLGA251_05770 (abcA)
    M013:
    M013TW_0631
    MRSA252:
    SAR0653
    MSHR1132:
    SAMSHR1132_05890
    MSSA476:
    SAS0609
    Mu3:
    SAHV_0640
    Mu50:
    SAV0643
    MW2:
    MW0605
    RF122:
    SAB0593
    ST398:
    SAPIG0722
    T0131:
    SAT0131_00713 (pcrB)
    TCH60:
    HMPREF0772_12544 (lmrA)
    TW20:
    SATW20_07180 (abcA)
    USA300_TCH1516:
    USA300HOU_0663
    VC40:
    SAVC_02850

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKRENPLFFLFKKLSWPVGLIVAAITISSLGSLSGLLVPLFTGRIVDKFSVSHINWNLIA
    N315            MKRENPLFFLFKKLSWPVGLIVAAITISSLGSLSGLLVPLFTGRIVDKFSVSHINWNLIA
    NCTC8325        MKRENPLFFLFKKLSWPVGLIVAAITISSLGSLSGLLVPLFTGRIVDKFSVSHINWNLIA
    Newman          MKRENPLFFLFKKLSWPVGLIVAAITISSLGSLSGLLVPLFTGRIVDKFSVSHINWNLIA
    USA300_FPR3757  MKRENPLFFLFKKLSWPVGLIVAAITISSLGSLSGLLVPLFTGRIVDKFSVSHINWNLIA
                    ************************************************************

    COL             LFGGIFVINALLSGLGLYLLSKIGEKIIYAIRSVLWEHIIQLKMPFFDKNESGQLMSRLT
    N315            LFGGIFVINALLSGLGLYLLSKIGEKIIYAIRSVLWEHIIQLKMPFFDKNESGQLMSRLT
    NCTC8325        LFGGIFVINALLSGLGLYLLSKIGEKIIYAIRSVLWEHIIQLKMPFFDKNESGQLMSRLT
    Newman          LFGGIFVINALLSGLGLYLLSKIGEKIIYAIRSVLWEHIIQLKMPFFDKNESGQLMSRLT
    USA300_FPR3757  LFGGIFVINALLSGLGLYLLSKIGEKIIYAIRSVLWEHIIQLKMPFFDKNESGQLMSRLT
                    ************************************************************

    COL             DDTKVINEFISQKLPNLLPSIVTLVGSLIMLFILDWKMTLLTFITIPIFVLIMIPLGRIM
    N315            DDTKVINEFISQKLPNLLPSIVTLVGSLIMLFILDWKMTLLTFITIPIFVLIMIPLGRIM
    NCTC8325        DDTKVINEFISQKLPNLLPSIVTLVGSLIMLFILDWKMTLLTFITIPIFVLIMIPLGRIM
    Newman          DDTKVINEFISQKLPNLLPSIVTLVGSLIMLFILDWKMTLLTFITIPIFVLIMIPLGRIM
    USA300_FPR3757  DDTKVINEFISQKLPNLLPSIVTLVGSLIMLFILDWKMTLLTFITIPIFVLIMIPLGRIM
                    ************************************************************

    COL             QKISTSTQSEIANFSGLLGRVLTEMRLVKISNTERLELDNAHKNLNEIYKLGLKQAKIAA
    N315            QKISTSTQSEIANFSGLLGRVLTEMRLVKISNTERLELDNAHKNLNEIYKLGLKQAKIAA
    NCTC8325        QKISTSTQSEIANFSGLLGRVLTEMRLVKISNTERLELDNAHKNLNEIYKLGLKQAKIAA
    Newman          QKISTSTQSEIANFSGLLGRVLTEMRLVKISNTERLELDNAHKNLNEIYKLGLKQAKIAA
    USA300_FPR3757  QKISTSTQSEIANFSGLLGRVLTEMRLVKISNTERLELDNAHKNLNEIYKLGLKQAKIAA
                    ************************************************************

    COL             VVQPISGIVMLLTIAIILGFGALEIATGAITAGTLIAMIFYVIQLSMPLINLSTLVTDYK
    N315            VVQPISGIVMLLTIAIILGFGALEIATGAITAGTLIAMIFYVIQLSMPLINLSTLVTDYK
    NCTC8325        VVQPISGIVMLLTIAIILGFGALEIATGAITAGTLIAMIFYVIQLSMPLINLSTLVTDYK
    Newman          VVQPISGIVMLLTIAIILGFGALEIATGAITAGTLIAMIFYVIQLSMPLINLSTLVTDYK
    USA300_FPR3757  VVQPISGIVMLLTIAIILGFGALEIATGAITAGTLIAMIFYVIQLSMPLINLSTLVTDYK
                    ************************************************************

    COL             KAVGASSRIYEIMQEPIEPTEALEDSENVLIDDGVLSFEHVDFKYDVKKILDDVSFQIPQ
    N315            KAVGASSRIYEIMQEPIEPTEALEDSENVLIDDGVLSFEHVDFKYDVKKILDDVSFQIPQ
    NCTC8325        KAVGASSRIYEIMQEPIEPTEALEDSENVLIDDGVLSFEHVDFKYDVKKILDDVSFQIPQ
    Newman          KAVGASSRIYEIMQEPIEPTEALEDSENVLIDDGVLSFEHVDFKYDVKKILDDVSFQIPQ
    USA300_FPR3757  KAVGASSRIYEIMQEPIEPTEALEDSENVLIDDGVLSFEHVDFKYDVKKILDDVSFQIPQ
                    ************************************************************

    COL             GQVSAFVGPSGSGKSTIFNLIERMYEIESGDIKYGLESVYDIPLSKWRRKIGYVMQSNSM
    N315            GQVSAFVGPSGSGKSTIFNLIERMYEIESGDIKYGLESVYDIPLSKWRRKIGYVMQSNSM
    NCTC8325        GQVSAFVGPSGSGKSTIFNLIERMYEIESGDIKYGLESVYDIPLSKWRRKIGYVMQSNSM
    Newman          GQVSAFVGPSGSGKSTIFNLIERMYEIESGDIKYGLESVYDIPLSKWRRKIGYVMQSNSM
    USA300_FPR3757  GQVSAFVGPSGSGKSTIFNLIERMYEIESGDIKYGLESVYDIPLSKWRRKIGYVMQSNSM
                    ************************************************************

    COL             MSGTIRDNILYGINRHVSDEELINYAKLANCHDFIMQFDEGYDTLVGERGLKLSGGQRQR
    N315            MSGTIRDNILYGINRHVSDEELINYAKLANCHDFIMQFDEGYDTLVGERGLKLSGGQRQR
    NCTC8325        MSGTIRDNILYGINRHVSDEELINYAKLANCHDFIMQFDEGYDTLVGERGLKLSGGQRQR
    Newman          MSGTIRDNILYGINRHVSDEELINYAKLANCHDFIMQFDEGYDTLVGERGLKLSGGQRQR
    USA300_FPR3757  MSGTIRDNILYGINRHVSDEELINYAKLANCHDFIMQFDEGYDTLVGERGLKLSGGQRQR
                    ************************************************************

    COL             IDIARSFVKNPDILLLDEATANLDSESELKIQEALETLMEGRTTIVIAHRLSTIKKAGQI
    N315            IDIARSFVKNPDILLLDEATANLDSESELKIQEALETLMEGRTTIVIAHRLSTIKKAGQI
    NCTC8325        IDIARSFVKNPDILLLDEATANLDSESELKIQEALETLMEGRTTIVIAHRLSTIKKAGQI
    Newman          IDIARSFVKNPDILLLDEATANLDSESELKIQEALETLMEGRTTIVIAHRLSTIKKAGQI
    USA300_FPR3757  IDIARSFVKNPDILLLDEATANLDSESELKIQEALETLMEGRTTIVIAHRLSTIKKAGQI
                    ************************************************************

    COL             IFLDKGQVTGKGTHSELMASHAKYKNFVVSQKLTD
    N315            IFLDKGQVTGKGTHSELMASHAKYKNFVVSQKLTD
    NCTC8325        IFLDKGQVTGKGTHSELMASHAKYKNFVVSQKLTD
    Newman          IFLDKGQVTGKGTHSELMASHAKYKNFVVSQKLTD
    USA300_FPR3757  IFLDKGQVTGKGTHSELMASHAKYKNFVVSQKLTD
                    ***********************************