From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002522000
  • symbol?: nupG
  • description?: pyrimidine nucleoside transporter

      descriptions from strain specific annotations:

    • pyrimidine nucleoside transporter
    • Na+ dependent nucleoside transporter
    • nucleoside permease NupC, putative
    • na+ dependent nucleoside transporter C-terminus family protein
    • putative nucleoside transporter
    • CNT family concentrative nucleoside transporter
    • putative Na+ dependent nucleoside transporter
    • Na+ dependent nucleoside transporter domain-containing protein
    • purine nucleoside transport protein nupG
    • Nucleoside permease
  • strand?: +
  • coordinates?: 3035007..3036236
  • synteny block?: BlockID0017580
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0621
    08BA02176:
    C248_0727
    11819-97:
    MS7_0695 (nupG)
    71193:
    ST398NM01_0723
    ECT-R 2:
    ECTR2_596
    ED133:
    SAOV_0679
    ED98:
    SAAV_0607
    HO 5096 0412:
    SAEMRSA15_05710
    JH1:
    SaurJH1_0682
    JH9:
    SaurJH9_0667
    JKD6008:
    SAA6008_00661 (nupC2)
    JKD6159:
    SAA6159_00599 (nupC2)
    LGA251:
    SARLGA251_05780
    M013:
    M013TW_0632
    MRSA252:
    SAR0655
    MSHR1132:
    SAMSHR1132_05900
    MSSA476:
    SAS0610
    Mu3:
    SAHV_0642
    Mu50:
    SAV0645
    MW2:
    MW0607
    RF122:
    SAB0594
    ST398:
    SAPIG0723
    T0131:
    SAT0131_00714
    TCH60:
    HMPREF0772_12543
    TW20:
    SATW20_07200
    USA300_TCH1516:
    USA300HOU_0665 (nupC2)
    VC40:
    SAVC_02855

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MFLLINIIGLIVFLGIAVLFSRDRKNIQWQSIGILVVLNLFLAWFFIYFDWGQKAVRGAA
    N315            MFLLINIIGLIVFLGIAVLFSRDRKNIQWQSIGILVVLNLFLAWFFIYFDWGQKAVRGAA
    NCTC8325        MFLLINIIGLIVFLGIAVLFSRDRKNIQWQSIGILVVLNLFLAWFFIYFDWGQKAVRGAA
    Newman          MFLLINIIGLIVFLGIAVLFSRDRKNIQWQSIGILVVLNLFLAWFFIYFDWGQKAVRGAA
    USA300_FPR3757  MFLLINIIGLIVFLGIAVLFSRDRKNIQWQSIGILVVLNLFLAWFFIYFDWGQKAVRGAA
                    ************************************************************

    COL             NGIAWVVQSAHAGTGFAFASLTNVKMMDMAVAALFPILLIVPLFDILMYFNILPKIIGGI
    N315            NGIAWVVQSAHAGTGFAFASLTNVKMMDMAVAALFPILLIVPLFDILMYFNILPKIIGGI
    NCTC8325        NGIAWVVQSAHAGTGFAFASLTNVKMMDMAVAALFPILLIVPLFDILMYFNILPKIIGGI
    Newman          NGIAWVVQSAHAGTGFAFASLTNVKMMDMAVAALFPILLIVPLFDILMYFNILPKIIGGI
    USA300_FPR3757  NGIAWVVQSAHAGTGFAFASLTNVKMMDMAVAALFPILLIVPLFDILMYFNILPKIIGGI
                    ************************************************************

    COL             GWLLAKVTRQPKFESFFGIEMMFLGNTEALAVSSEQLKRMNEMRVLTIAMMSMSSVSGAI
    N315            GWLLAKVTRQPKFESFFGIEMMFLGNTEALAVSSEQLKRMNEMRVLTIAMMSMSSVSGAI
    NCTC8325        GWLLAKVTRQPKFESFFGIEMMFLGNTEALAVSSEQLKRMNEMRVLTIAMMSMSSVSGAI
    Newman          GWLLAKVTRQPKFESFFGIEMMFLGNTEALAVSSEQLKRMNEMRVLTIAMMSMSSVSGAI
    USA300_FPR3757  GWLLAKVTRQPKFESFFGIEMMFLGNTEALAVSSEQLKRMNEMRVLTIAMMSMSSVSGAI
                    ************************************************************

    COL             VGAYVQMVPGELVLTAIPLNIVNAIIVSCLLNPVSVEEKEDIIYSLKNNEVERQPFFSFL
    N315            VGAYVQMVPGELVLTAIPLNIVNAIIVSCLLNPVSVEEKEDIIYSLKNNEVERQPFFSFL
    NCTC8325        VGAYVQMVPGELVLTAIPLNIVNAIIVSCLLNPVSVEEKEDIIYSLKNNEVERQPFFSFL
    Newman          VGAYVQMVPGELVLTAIPLNIVNAIIVSCLLNPVSVEEKEDIIYSLKNNEVERQPFFSFL
    USA300_FPR3757  VGAYVQMVPGELVLTAIPLNIVNAIIVSCLLNPVSVEEKEDIIYSLKNNEVERQPFFSFL
                    ************************************************************

    COL             GDSVLAAGKLVLIIIAFVISFVALADLFDRFINLITGLIAGWIGIKGSFGLNQILGVFMY
    N315            GDSVLAAGKLVLIIIAFVISFVALADLFDRFINLITGLIAGWIGIKGSFGLNQILGVFMY
    NCTC8325        GDSVLAAGKLVLIIIAFVISFVALADLFDRFINLITGLIAGWIGIKGSFGLNQILGVFMY
    Newman          GDSVLAAGKLVLIIIAFVISFVALADLFDRFINLITGLIAGWIGIKGSFGLNQILGVFMY
    USA300_FPR3757  GDSVLAAGKLVLIIIAFVISFVALADLFDRFINLITGLIAGWIGIKGSFGLNQILGVFMY
                    ************************************************************

    COL             PFALLLGLPYDEAWLVAQQMAKKIVTNEFVVMGEISKDIASYTPHHRAVITTFLISFANF
    N315            PFALLLGLPYDEAWLVAQQMAKKIVTNEFVVMGEISKDIASYTPHHRAVITTFLISFANF
    NCTC8325        PFALLLGLPYDEAWLVAQQMAKKIVTNEFVVMGEISKDIASYTPHHRAVITTFLISFANF
    Newman          PFALLLGLPYDEAWLVAQQMAKKIVTNEFVVMGEISKDIASYTPHHRAVITTFLISFANF
    USA300_FPR3757  PFALLLGLPYDEAWLVAQQMAKKIVTNEFVVMGEISKDIASYTPHHRAVITTFLISFANF
                    ************************************************************

    COL             STIGMIIGTLKGIVDKKTSDFVSKYVPMMLLSGILVSLLTAAFVGLFAW
    N315            STIGMIIGTLKGIVDKKTSDFVSKYVPMMLLSGILVSLLTAAFVGLFAW
    NCTC8325        STIGMIIGTLKGIVDKKTSDFVSKYVPMMLLSGILVSLLTAAFVGLFAW
    Newman          STIGMIIGTLKGIVDKKTSDFVSKYVPMMLLSGILVSLLTAAFVGLFAW
    USA300_FPR3757  STIGMIIGTLKGIVDKKTSDFVSKYVPMMLLSGILVSLLTAAFVGLFAW
                    *************************************************