From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002524000
  • symbol?:
  • description?: putative ABC transporter permease

      descriptions from strain specific annotations:

    • putative ABC transporter permease
    • YitT family protein
    • YxkD
    • membrane spanning protein
    • YxkD like protein
  • strand?: +
  • coordinates?: 3036782..3037615
  • synteny block?: BlockID0017600
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0622
    08BA02176:
    C248_0729
    11819-97:
    MS7_0696
    71193:
    ST398NM01_0724
    ECT-R 2:
    ECTR2_597
    ED133:
    SAOV_0680
    ED98:
    SAAV_0608
    HO 5096 0412:
    SAEMRSA15_05720
    JH1:
    SaurJH1_0684
    JH9:
    SaurJH9_0669
    JKD6008:
    SAA6008_00662
    JKD6159:
    SAA6159_00600
    LGA251:
    SARLGA251_05790
    M013:
    M013TW_0633
    MRSA252:
    SAR0656
    MSHR1132:
    SAMSHR1132_05910
    MSSA476:
    SAS0611
    Mu3:
    SAHV_0643
    Mu50:
    SAV0646
    MW2:
    MW0608
    RF122:
    SAB0595
    ST398:
    SAPIG0724
    T0131:
    SAT0131_00716 (purB)
    TCH60:
    HMPREF0772_12542
    TW20:
    SATW20_07210
    USA300_TCH1516:
    USA300HOU_0667
    VC40:
    SAVC_02860

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNKTVKDLILVVLGSFIFAAGVNAFIISGNLGEGGVTGLAIILYYAFHISPAITNFLVNA
    N315            ------------------------------------------------------------
    NCTC8325        MNKTVKDLILVVLGSFIFAAGVNAFIISGNLGEGGVTGLAIILYYAFHISPAITNFLVNA
    Newman          MNKTVKDLILVVLGSFIFAAGVNAFIISGNLGEGGVTGLAIILYYAFHISPAITNFLVNA
    USA300_FPR3757  MNKTVKDLILVVLGSFIFAAGVNAFIISGNLGEGGVTGLAIILYYAFHISPAITNFLVNA
                                                                                

    COL             VLIAIGYKFLSKRSMYLTILVTILISIFLSLTESWQVETGNSIVNAIFGGVSVGLGIGVI
    N315            --------------MYLTILVTILISIFLSLTESWQVETGNSIVNAIFGGVSVGLGIGVI
    NCTC8325        VLIAIGYKFLSKRSMYLTILVTILISIFLSLTESWQVETGNSIVNAIFGGVSVGLGIGVI
    Newman          VLIAIGYKFLSKRSMYLTILVTILISIFLSLTESWQVETGNSIVNAIFGGVSVGLGIGVI
    USA300_FPR3757  VLIAIGYKFLSKRSMYLTILVTILISIFLSLTESWQVETGNSIVNAIFGGVSVGLGIGVI
                                  **********************************************

    COL             ILAGGTTAGTTILARIATKYLDVSTPYALLFFDMIVVAISLTVIPLDKVLVTVISLYIGT
    N315            ILAGGTTAGTTILARIATKYLDVSTPYALLFFDMIVVAISLTVIPLDKVLVTVISLYIGT
    NCTC8325        ILAGGTTAGTTILARIATKYLDVSTPYALLFFDMIVVAISLTVIPLDKVLVTVISLYIGT
    Newman          ILAGGTTAGTTILARIATKYLDVSTPYALLFFDMIVVAISLTVIPLDKVLVTVISLYIGT
    USA300_FPR3757  ILAGGTTAGTTILARIATKYLDVSTPYALLFFDMIVVAISLTVIPLDKVLVTVISLYIGT
                    ************************************************************

    COL             KVMEYVIEGLNTKKAMTIISTNPDKLAKAIDEQIGRGLTILNGHGYYTREEKDVLYVVIS
    N315            KVMEYVIEGLNTKKAMTIISTNPDKLAKAIDEQIGRGLTILNGHGYYTREEKDVLYVVIS
    NCTC8325        KVMEYVIEGLNTKKAMTIISTNPDKLAKAIDEQIGRGLTILNGHGYYTREEKDVLYVVIS
    Newman          KVMEYVIEGLNTKKAMTIISTNPDKLAKAIDEQIGRGLTILNGHGYYTREEKDVLYVVIS
    USA300_FPR3757  KVMEYVIEGLNTKKAMTIISTNPDKLAKAIDEQIGRGLTILNGHGYYTREEKDVLYVVIS
                    ************************************************************

    COL             KTQVSKAKRLIKQIDKDAFLVIHDVRDVYGNGFLADE
    N315            KTQVSKAKRLIKQIDKDAFLVIHDVRDVYGNGFLADE
    NCTC8325        KTQVSKAKRLIKQIDKDAFLVIHDVRDVYGNGFLADE
    Newman          KTQVSKAKRLIKQIDKDAFLVIHDVRDVYGNGFLADE
    USA300_FPR3757  KTQVSKAKRLIKQIDKDAFLVIHDVRDVYGNGFLADE
                    *************************************