From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002525000
  • symbol?: fhuC
  • description?: ABC transporter ATP-binding protein

      descriptions from strain specific annotations:

    • ABC transporter ATP-binding protein
    • iron compound ABC transporter ATP-binding protein
    • ferrichrome transport ATP-binding protein fhuA
    • ferrichrome ABC transporter ATP-binding protein
    • ferrichrome transport ATP-binding protein fhuC
    • ABC transporter family protein
    • ABC transporter-like protein
    • ferrichrome ABC superfamily ATP binding cassette transporter, ABC protein
    • FhuC protein
    • iron (Fe3+) ABC superfamily ATP binding cassette transporter, ABC protein
    • iron (Fe3+) ABC transporter ATP-binding protein
    • iron compound ABC transporter, ATP-binding protein
  • strand?: +
  • coordinates?: 3037903..3038700
  • synteny block?: BlockID0017610
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    SA0602 (fhuA)
    NCTC8325:
    Newman:
    NWMN_0616 (fhuA)
    USA300_FPR3757:
    04-02981:
    SA2981_0623 (fhuA)
    08BA02176:
    C248_0730 (fhuA)
    11819-97:
    MS7_0697
    71193:
    ST398NM01_0725
    ECT-R 2:
    ECTR2_598
    ED133:
    SAOV_0681
    ED98:
    SAAV_0609
    HO 5096 0412:
    SAEMRSA15_05730 (fhuA)
    JH1:
    SaurJH1_0685
    JH9:
    SaurJH9_0670
    JKD6008:
    SAA6008_00663 (fhuA)
    JKD6159:
    SAA6159_00601 (fhuA)
    LGA251:
    SARLGA251_05800 (fhuC)
    M013:
    M013TW_0634
    MRSA252:
    SAR0657 (fhuA)
    MSHR1132:
    SAMSHR1132_05920
    MSSA476:
    SAS0612
    Mu3:
    SAHV_0644 (fhuA)
    Mu50:
    SAV0647 (fhuA)
    MW2:
    MW0609 (fhuA)
    RF122:
    SAB0596 (fhuA)
    ST398:
    SAPIG0725
    T0131:
    SAT0131_00717
    TCH60:
    HMPREF0772_12541 (fhuC)
    TW20:
    SATW20_07220 (fhuC)
    USA300_TCH1516:
    USA300HOU_0668 (fhuC)
    VC40:
    SAVC_02865

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNRLHGQQVKIGYGDNTIINKLDVEIPDGKVTSIIGPNGCGKSTLLKALSRLLAVKEGEV
    N315            MNRLHGQQVKIGYGDNTIINKLDVEIPDGKVTSIIGPNGCGKSTLLKALSRLLAVKEGEV
    NCTC8325        MNRLHGQQVKIGYGDNTIINKLDVEIPDGKVTSIIGPNGCGKSTLLKALSRLLAVKEGEV
    Newman          MNRLHGQQVKIGYGDNTIINKLDVEIPDGKVTSIIGPNGCGKSTLLKALSRLLAVKEGEV
    USA300_FPR3757  MNRLHGQQVKIGYGDNTIINKLDVEIPDGKVTSIIGPNGCGKSTLLKALSRLLAVKEGEV
                    ************************************************************

    COL             FLDGENIHTQSTKEIAKKIAILPQSPEVADGLTVGELVSYGRFPHQKGFGRLTAEDKKEI
    N315            FLDGENIHTQSTKEIAKKIAILPQSPEVADGLTVGELVSYGRFPHQKGFGRLTAEDKKEI
    NCTC8325        FLDGENIHTQSTKEIAKKIAILPQSPEVADGLTVGELVSYGRFPHQKGFGRLTAEDKKEI
    Newman          FLDGENIHTQSTKEIAKKIAILPQSPEVADGLTVGELVSYGRFPHQKGFGRLTAEDKKEI
    USA300_FPR3757  FLDGENIHTQSTKEIAKKIAILPQSPEVADGLTVGELVSYGRFPHQKGFGRLTAEDKKEI
                    ************************************************************

    COL             DWAMEVTGTDTFRHRSINDLSGGQRQRVWIAMALAQRTDIIFLDEPTTYLDICHQLEILE
    N315            DWAMEVTGTDTFRHRSINDLSGGQRQRVWIAMALAQRTDIIFLDEPTTYLDICHQLEILE
    NCTC8325        DWAMEVTGTDTFRHRSINDLSGGQRQRVWIAMALAQRTDIIFLDEPTTYLDICHQLEILE
    Newman          DWAMEVTGTDTFRHRSINDLSGGQRQRVWIAMALAQRTDIIFLDEPTTYLDICHQLEILE
    USA300_FPR3757  DWAMEVTGTDTFRHRSINDLSGGQRQRVWIAMALAQRTDIIFLDEPTTYLDICHQLEILE
                    ************************************************************

    COL             LVQKLNQEQGCTIVMVLHDINQAIRFSDHLIAMKEGDIIATGSTEDVLTQEILEKVFNID
    N315            LVQKLNQEQGCTIVMVLHDINQAIRFSDHLIAMKEGDIIATGSTEDVLTQEILEKVFNID
    NCTC8325        LVQKLNQEQGCTIVMVLHDINQAIRFSDHLIAMKEGDIIATGSTEDVLTQEILEKVFNID
    Newman          LVQKLNQEQGCTIVMVLHDINQAIRFSDHLIAMKEGDIIATGSTEDVLTQEILEKVFNID
    USA300_FPR3757  LVQKLNQEQGCTIVMVLHDINQAIRFSDHLIAMKEGDIIATGSTEDVLTQEILEKVFNID
                    ************************************************************

    COL             VVLSKDPKTGKPLLVTYDLCRRAYS
    N315            VVLSKDPKTGKPLLVTYDLCRRAYS
    NCTC8325        VVLSKDPKTGKPLLVTYDLCRRAYS
    Newman          VVLSKDPKTGKPLLVTYDLCRRAYS
    USA300_FPR3757  VVLSKDPKTGKPLLVTYDLCRRAYS
                    *************************