From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002527000
  • symbol?: fhuG
  • description?: iron ABC transporter permease

      descriptions from strain specific annotations:

    • iron ABC transporter permease
    • ferrichrome ABC transporter permease
    • ferrichrome transport permease fhuG
    • iron compound ABC transporter permease
    • Ferrichrome transport system permease protein fhuG
    • transport system permease protein
    • Fe3+-siderophore ABC transporter permease 2 component
    • fecCD transport family protein
    • ferrichrome ABC superfamily ATP binding cassette transporter, binding protein
    • iron (Fe3+) ABC transporter membrane protein
    • iron compound ABC transporter, permease protein
    • iron-dicitrate transporter subunit FecD
  • strand?: +
  • coordinates?: 3039737..3040753
  • synteny block?: BlockID0017630
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    SA0604 (fhuG)
    NCTC8325:
    Newman:
    NWMN_0618 (fhuG)
    USA300_FPR3757:
    04-02981:
    SA2981_0625 (fhuG)
    08BA02176:
    C248_0732 (fhuD)
    11819-97:
    MS7_0699
    71193:
    ST398NM01_0727
    ECT-R 2:
    ECTR2_600
    ED133:
    SAOV_0683
    ED98:
    SAAV_0611
    HO 5096 0412:
    SAEMRSA15_05750 (fhuD)
    JH1:
    SaurJH1_0687
    JH9:
    SaurJH9_0672
    JKD6008:
    SAA6008_00665
    JKD6159:
    SAA6159_00603 (fecD)
    LGA251:
    SARLGA251_05820 (fhuD)
    M013:
    M013TW_0636
    MRSA252:
    SAR0659 (fhuD)
    MSHR1132:
    SAMSHR1132_05940
    MSSA476:
    SAS0614
    Mu3:
    SAHV_0646 (fhuG)
    Mu50:
    SAV0649 (fhuG)
    MW2:
    MW0611 (fhuG)
    RF122:
    SAB0598 (fhuD)
    ST398:
    SAPIG0727
    T0131:
    SAT0131_00719
    TCH60:
    HMPREF0772_12539 (fhuD)
    TW20:
    SATW20_07240 (fhuD)
    USA300_TCH1516:
    USA300HOU_0670 (fhuG)
    VC40:
    SAVC_02875

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MISSNNKRRQLIALAVFSILLFLGCTWSITSGEYNIPVERFFKTLIGQGDAIDELILLDF
    N315            MISSNNKRRQLIALAVFSILLFLGCTWSITSGEYNIPVERFFKTLIGQGDAIDELILLDF
    NCTC8325        MISSNNKRRQLIALAVFSILLFLGCTWSITSGEYNIPVERFFKTLIGQGDAIDELILLDF
    Newman          MISSNNKRRQLIALAVFSILLFLGCTWSITSGEYNIPVERFFKTLIGQGDAIDELILLDF
    USA300_FPR3757  MISSNNKRRQLIALAVFSILLFLGCTWSITSGEYNIPVERFFKTLIGQGDAIDKLILLDF
                    *****************************************************:******

    COL             RLPRMMITILAGAALSISGAIVQSVTKNPIAEPGILGINAGGGFAIALFIAIGKINADNF
    N315            RLPRMMITILAGAALSISGAIVQSVTKNPIAEPGILGINAGGGFAIALFIAIGKINADNF
    NCTC8325        RLPRMMITILAGAALSISGAIVQSVTKNPIAEPGILGINAGGGFAIALFIAIGKINADNF
    Newman          RLPRMMITILAGAALSISGAIVQSVTKNPIAEPGILGINAGGGFAIALFIAIGKINADNF
    USA300_FPR3757  RLPRMMITILAGAALSISGAIVQSVTKNPIAEPGILGINAGGGFAIALFIAIGKINADNF
                    ************************************************************

    COL             VYVLPLISILGGITTALIIFIFSFNKNEGVTPASMVLIGVGLQTALYGGSITIMSKFDDK
    N315            VYVLPLISILGGITTALIIFIFSFNKNEGVTPASMVLIGVGLQTALYGGSITIMSKFDDK
    NCTC8325        VYVLPLISILGGITTALIIFIFSFNKNEGVTPASMVLIGVGLQTALYGGSITIMSKFDDK
    Newman          VYVLPLISILGGITTALIIFIFSFNKNEGVTPASMVLIGVGLQTALYGGSITIMSKFDDK
    USA300_FPR3757  VYVLPLISILGGITTALIIFIFSFNKNEGVTPASMVLIGVGLQTALYGGSITIMSKFDDK
                    ************************************************************

    COL             QSDFIAAWFAGNIWGDEWPFVIAFLPWVLIIIPYLLFKSNTLNIIHTGDNIARGLGVRLS
    N315            QSDFIAAWFAGNIWGDEWPFVIAFLPWVLIIIPYLLFKSNTLNIIHTGDNIARGLGVRLS
    NCTC8325        QSDFIAAWFAGNIWGDEWPFVIAFLPWVLIIIPYLLFKSNTLNIIHTGDNIARGLGVRLS
    Newman          QSDFIAAWFAGNIWGDEWPFVIAFLPWVLIIIPYLLFKSNTLNIIHTGDNIARGLGVRLS
    USA300_FPR3757  QSDFIAAWFAGNIWGDEWPFVIAFLPWVLIIIPYLLFKSNTLNIIHTGDNIARGLGVRLS
                    ************************************************************

    COL             RERLILFFIAVMLSSAAVAVAGSISFIGLMGPHIAKRIVGPRHQLFLPIAILVGACLLVI
    N315            RERLILFFIAVMLSSAAVAVAGSISFIGLMGPHIAKRIVGPRHQLFLPIAILVGACLLVI
    NCTC8325        RERLILFFIAVMLSSAAVAVAGSISFIGLMGPHIAKRIVGPRHQLFLPIAILVGACLLVI
    Newman          RERLILFFIAVMLSSAAVAVAGSISFIGLMGPHIAKRIVGPRHQLFLPIAILVGACLLVI
    USA300_FPR3757  RERLILFFIAVMLSSAAVAVAGSISFIGLMGPHIAKRIVGPRHQLFLPIAILVGACLLVI
                    ************************************************************

    COL             ADTIGKIVLQPGGVPAGIVVAIIGAPYFLYLMYKTKNV
    N315            ADTIGKIVLQPGGVPAGIVVAIIGAPYFLYLMYKTKNV
    NCTC8325        ADTIGKIVLQPGGVPAGIVVAIIGAPYFLYLMYKTKNV
    Newman          ADTIGKIVLQPGGVPAGIVVAIIGAPYFLYLMYKTKNV
    USA300_FPR3757  ADTIGKIVLQPGGVPAGIVVAIIGAPYFLYLMYKTKNV
                    **************************************