From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002528000
  • symbol?: dhaK
  • description?: dihydroxyacetone kinase subunit DhaK

      descriptions from strain specific annotations:

    • dihydroxyacetone kinase subunit DhaK
    • putative dihydroxyacetone kinase
    • Phosphoenolpyruvate-dihydroxyacetone phosphotransferase, dihydroxyacetone binding subunit DhaK
    • dihydroxyacetone kinase family protein
    • Dihydroxyacetone kinase, DhaK subunit
  • strand?: +
  • coordinates?: 3041024..3041992
  • synteny block?: BlockID0017640
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0626 (dhaK)
    08BA02176:
    C248_0733
    11819-97:
    MS7_0700 (dhaK)
    71193:
    ST398NM01_0728
    ECT-R 2:
    ECTR2_601 (dhaK)
    ED133:
    SAOV_0684
    ED98:
    SAAV_0612
    HO 5096 0412:
    SAEMRSA15_05760
    JH1:
    SaurJH1_0688
    JH9:
    SaurJH9_0673
    JKD6008:
    SAA6008_00666
    JKD6159:
    SAA6159_00604
    LGA251:
    SARLGA251_05830
    M013:
    M013TW_0637
    MRSA252:
    SAR0660
    MSHR1132:
    SAMSHR1132_05960
    MSSA476:
    SAS0615
    Mu3:
    SAHV_0647
    Mu50:
    SAV0650
    MW2:
    MW0612
    RF122:
    SAB0599
    ST398:
    SAPIG0728 (dhaK)
    T0131:
    SAT0131_00720
    TCH60:
    HMPREF0772_12538 (dhaK)
    TW20:
    SATW20_07250
    USA300_TCH1516:
    USA300HOU_0671
    VC40:
    SAVC_02880

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             -MKKLINKKETFLTDMLEGLLIAHPELDLIANTVIVKKAKKEHGVAIVSGGGSGHEPAHA
    N315            -MKKLINKKETFLTDMLEGLLIAHPELDLIANTVIVKKAKKEHGVAIVSGGGSGHEPAHA
    NCTC8325        MMKKLINKKETFLTDMLEGLLIAHPELDLIANTVIVKKAKKEHGVAIVSGGGSGHEPAHA
    Newman          MMKKLINKKETFLTDMLEGLLIAHPELDLIANTVIVKKAKKEHGVAIVSGGGSGHEPAHA
    USA300_FPR3757  MMKKLINKKETFLTDMLEGLLIAHPELDLIANTVIVKKAKKEHGVAIVSGGGSGHEPAHA
                     ***********************************************************

    COL             GFVAEGMLDAAVCGEVFTSPTPDKILEAIKAVDTGDGVLLVVKNYAGDVMNFEMAQELAE
    N315            GFVAEGMLDAAVCGEVFTSPTPDKILEAIKAVDTGDGVLLVVKNYAGDVMNFEMAQELAE
    NCTC8325        GFVAEGMLDAAVCGEVFTSPTPDKILEAIKAVDTGDGVLLVVKNYAGDVMNFEMAQELAE
    Newman          GFVAEGMLDAAVCGEVFTSPTPDKILEAIKAVDTGDGVLLVVKNYAGDVMNFEMAQELAE
    USA300_FPR3757  GFVAEGMLDAAVCGEVFTSPTPDKILEAIKAVDTGDGVLLVVKNYAGDVMNFEMAQELAE
                    ************************************************************

    COL             MEGINVQTVIVRDDIAVTNEVQRRGVAGTVFVHKLAGYLAEKGYSLTEIKSRVEALLPEI
    N315            MEGINVQTVIVRDDIAVTNEVQRRGVAGTVFVHKLAGYLAEKGYSLTEIKSRVEALLPEI
    NCTC8325        MEGINVQTVIVRDDIAVTNEVQRRGVAGTVFVHKLAGYLAEKGYSLTEIKSRVEALLPEI
    Newman          MEGINVQTVIVRDDIAVTNEVQRRGVAGTVFVHKLAGYLAEKGYSLTEIKSRVEALLPEI
    USA300_FPR3757  MEGINVQTVIVRDDIAVTNEVQRRGVAGTVFVHKLAGYLAEKGYSLTEIKSRVEALLPEI
                    ************************************************************

    COL             KSIGMAIEPPLVPTTGKYGFDIEDDKMEIGIGIHGEKGIHREEVKDIDHIVGTLLDELYK
    N315            KSIGMAIEPPLVPTTGKYGFDIEDDKMEIGIGIHGEKGIHREEVKDIDHIVGTLLDELYK
    NCTC8325        KSIGMAIEPPLVPTTGKYGFDIEDDKMEIGIGIHGEKGIHREEVKDIDHIVGTLLDELYK
    Newman          KSIGMAIEPPLVPTTGKYGFDIEDDKMEIGIGIHGEKGIHREEVKDIDHIVGTLLDELYK
    USA300_FPR3757  KSIGMAIEPPLVPTTGKYGFDIEDDKMEIGIGIHGEKGIHREEVKDIDHIVGTLLDELYK
                    ************************************************************

    COL             EVTANDVILMVNGMGGTPLSELNIVTKYIQQNLAARTVNVAKWFVGDYMTSLDMQGFSIT
    N315            EVTANDVILMVNGMGGTPLSELNIVTKYIQQNLAARTVNVAKWFVGDYMTSLDMQGFSIT
    NCTC8325        EVTANDVILMVNGMGGTPLSELNIVTKYIQQNLAARTVNVAKWFVGDYMTSLDMQGFSIT
    Newman          EVTANDVILMVNGMGGTPLSELNIVTKYIQQNLAARTVNVAKWFVGDYMTSLDMQGFSIT
    USA300_FPR3757  EVTANDVILMVNGMGGTPLSELNIVTKYIQQNLAARTVNVAKWFVGDYMTSLDMQGFSIT
                    ************************************************************

    COL             IVPNKPEYLEAFLAPTTSQYFK
    N315            IVPNKPEYLEAFLAPTTSQYFK
    NCTC8325        IVPNKPEYLEAFLAPTTSQYFK
    Newman          IVPNKPEYLEAFLAPTTSQYFK
    USA300_FPR3757  IVPNKPEYLEAFLAPTTSQYFK
                    **********************