From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002529000
  • symbol?: dhaL
  • description?: dihydroxyacetone kinase subunit L

      descriptions from strain specific annotations:

    • dihydroxyacetone kinase subunit L
    • DAK2 domain-containing protein
    • dihydroxyacetone kinase subunit DhaL
    • Phosphoenolpyruvate-dihydroxyacetone phosphotransferase, ADP-binding subunit DhaL
    • dihydroxyacetone kinase
    • dihydroxyacetone kinase, DhaL subunit
    • dihydroxyacetone kinase, L subunit
    • glycerone kinase
    • putative dihydroxyacetone kinase
  • strand?: +
  • coordinates?: 3042028..3042621
  • synteny block?: BlockID0017650
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0627 (dhaL)
    08BA02176:
    C248_0734
    11819-97:
    MS7_0701 (dhaL)
    71193:
    ST398NM01_0729
    ECT-R 2:
    ECTR2_602
    ED133:
    SAOV_0685
    ED98:
    SAAV_0613
    HO 5096 0412:
    SAEMRSA15_05770
    JH1:
    SaurJH1_0689
    JH9:
    SaurJH9_0674
    JKD6008:
    SAA6008_00667
    JKD6159:
    SAA6159_00605
    LGA251:
    SARLGA251_05840
    M013:
    M013TW_0638
    MRSA252:
    SAR0661
    MSHR1132:
    SAMSHR1132_05970
    MSSA476:
    SAS0616
    Mu3:
    SAHV_0648
    Mu50:
    SAV0651
    MW2:
    MW0613
    RF122:
    SAB0600
    ST398:
    SAPIG0729
    T0131:
    SAT0131_00721 (nadE)
    TCH60:
    HMPREF0772_12537
    TW20:
    SATW20_07260
    USA300_TCH1516:
    USA300HOU_0672
    VC40:
    SAVC_02885

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKVNDMKARLLNLEETFKKHESELTELDRAIGDGDHGVNMVRGFSSLKDKLDDSSMQSLF
    N315            MKVNDMKARLLNLEETFKKHESELTELDRAIGDGDHGVNMVRGFSSLKDKLDDSSMQSLF
    NCTC8325        MKVNDMKARLLNLEETFKKHESELTELDRAIGDGDHGVNMVRGFSSLKDKLDDSSMQSLF
    Newman          MKVNDMKARLLNLEETFKKHESELTELDRAIGDGDHGVNMVRGFSSLKDKLDDSSMQSLF
    USA300_FPR3757  MKVNDMKARLLNLEETFKKHESELTELDRAIGDGDHGVNMVRGFSSLKDKLDDSSMQSLF
                    ************************************************************

    COL             KSTGMALMSNVGGASGPLYGFSFVKMSAVTKDDMDNQDFITLIQAFAEAVESRGKVTLNE
    N315            KSTGMALMSNVGGASGPLYGFSFVKMSAVTKDDMDNQDFITLIQAFAEAVESRGKVTLNE
    NCTC8325        KSTGMALMSNVGGASGPLYGFSFVKMSAVTKDDMDNQDFITLIQAFAEAVESRGKVTLNE
    Newman          KSTGMALMSNVGGASGPLYGFSFVKMSAVTKDDMDNQDFITLIQAFAEAVESRGKVTLNE
    USA300_FPR3757  KSTGMALMSNVGGASGPLYGFSFVKMSAVTKDDMDNQDFITLIQAFAEAVESRGKVTLNE
                    ************************************************************

    COL             KTMYDVVARAAEKLKNGETLTFNDLQQLADNTKDMVATKGRAAYFGEESKGYIDPGAQSM
    N315            KTMYDVVARAAEKLENGETLTFNDLQQLADNTKDMVATKGRAAYFGEESKGYIDPGAQSM
    NCTC8325        KTMYDVVARAAEKLKNGETLTFNDLQQLADNTKDMVATKGRAAYFGEESKGYIDPGAQSM
    Newman          KTMYDVVARAAEKLKNGETLTFNDLQQLADNTKDMVATKGRAAYFGEESKGYIDPGAQSM
    USA300_FPR3757  KTMYDVVARAAEKLKNGETLTFNDLQQLADNTKDMVATKGRAAYFGEESKGYIDPGAQSM
                    **************:*********************************************

    COL             VYILNALIGDEDNA
    N315            VYILNALIGDEDNA
    NCTC8325        VYILNALIGDEDNA
    Newman          VYILNALIGDEDNA
    USA300_FPR3757  VYILNALIGDEDNA
                    **************