From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002532000
  • symbol?:
  • description?: branched-chain amino acid transport family protein

      descriptions from strain specific annotations:

    • branched-chain amino acid transport family protein
    • branched-chain amino acid transport system II carrier protein
    • branched-chain amino acid transport protein
    • membrane spanning protein
  • strand?: +
  • coordinates?: 3044232..3045299
  • synteny block?: BlockID0017680
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0630
    08BA02176:
    C248_0737
    11819-97:
    MS7_0704
    71193:
    ST398NM01_0732
    ECT-R 2:
    ECTR2_605
    ED133:
    SAOV_0688
    ED98:
    SAAV_0616
    HO 5096 0412:
    SAEMRSA15_05800
    JH1:
    SaurJH1_0692
    JH9:
    SaurJH9_0677
    JKD6008:
    SAA6008_00670
    JKD6159:
    SAA6159_00608
    LGA251:
    SARLGA251_05870
    M013:
    M013TW_0641
    MRSA252:
    SAR0664
    MSHR1132:
    SAMSHR1132_06000
    MSSA476:
    SAS0619
    Mu3:
    SAHV_0651
    Mu50:
    SAV0654
    MW2:
    MW0616
    RF122:
    SAB0603
    ST398:
    SAPIG0732
    T0131:
    SAT0131_00724
    TCH60:
    HMPREF0772_12534
    TW20:
    SATW20_07290
    USA300_TCH1516:
    USA300HOU_0675
    VC40:
    SAVC_02900

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MMMNKEATKIGFAYVGIVVGAGFSTGQEVMQFFTKYGLWAYLGVIISGFILAFIGRQVAK
    N315            -----------------------------MQFFTKYGLWAYLGVIISGFILAFIGRQVAK
    NCTC8325        MMMNKEATKIGFAYVGIVVGAGFSTGQEVMQFFTKYGLWAYLGVIISGFILAFIGRQVAK
    Newman          MMMNKEATKIGFAYVGIVVGAGFSTGQEVMQFFTKYGLWAYLGVIISGFILAFIGRQVAK
    USA300_FPR3757  MMMNKEATKIGFAYVGIVVGAGFSTGQEVMQFFTKYGLWAYLGVIISGFILAFIGRQVAK
                                                 *******************************

    COL             IGTAFEATNHESTLQYVFGEKFSKVFDYILIFFLFGIAVTMIAGAGATFEESYNIPTWLG
    N315            IGTAFEATNHESTLQYVFGEKFSKVFDYILIFFLFGIAVTMIAGAGATFEESYNIPTWLG
    NCTC8325        IGTAFEATNHESTLQYVFGEKFSKVFDYILIFFLFGIAVTMIAGAGATFEESYNIPTWLG
    Newman          IGTAFEATNHESTLQYVFGEKFSKVFDYILIFFLFGIAVTMIAGAGATFEESYNIPTWLG
    USA300_FPR3757  IGTAFEATNHESTLQYVFGEKFSKVFDYILIFFLFGIAVTMIAGAGATFEESYNIPTWLG
                    ************************************************************

    COL             ALIMTLAIYITLLLDFNKIVRALGIVTPFLIVLVVLIAGVYLFKGHVSLAEVNQVVPEAS
    N315            ALIMTLAIYITLLLDFNKIVRALGIVTPFLIVLVVLIAGVYLFKGHVSLAEVNQVVPEAS
    NCTC8325        ALIMTLAIYITLLLDFNKIVRALGIVTPFLIVLVVLIAGVYLFKGHVSLAEVNQVVPEAS
    Newman          ALIMTLAIYITLLLDFNKIVRALGIVTPFLIVLVVLIAGVYLFKGHVSLAEVNQVVPEAS
    USA300_FPR3757  ALIMTLAIYITLLLDFNKIVRALGIVTPFLIVLVVLIAGVYLFKGHVSLAEVNQVVPEAS
                    ************************************************************

    COL             IWKGIWFGTIYGGLAFSVGFSTIVAIGGDTEKRTVSGAGAMYGGIIYTVLLALINFALQS
    N315            IWKGIWFGTIYGGLAFSVGFSTIVAIGGDTEKRTVSGAGAMYGGIIYTVLLALINFALQS
    NCTC8325        IWKGIWFGTIYGGLAFSVGFSTIVAIGGDTEKRTVSGAGAMYGGIIYTVLLALINFALQS
    Newman          IWKGIWFGTIYGGLAFSVGFSTIVAIGGDTEKRTVSGAGAMYGGIIYTVLLALINFALQS
    USA300_FPR3757  IWKGIWFGTIYGGLAFSVGFSTIVAIGGDTEKRTVSGAGAMYGGIIYTVLLALINFALQS
                    ************************************************************

    COL             EYPTIKNASIPTLTLANNIHPLIATVLSVIMLAVMYNTILGLMYSFAARFTEPYSKNYHI
    N315            EYPTIKNASIPTLTLANNIHPLIATVLSVIMLAVMYNTILGLMYSFAARFTEPYSKNYHI
    NCTC8325        EYPTIKNASIPTLTLANNIHPLIATVLSVIMLAVMYNTILGLMYSFAARFTEPYSKNYHI
    Newman          EYPTIKNASIPTLTLANNIHPLIATVLSVIMLAVMYNTILGLMYSFAARFTEPYSKNYHI
    USA300_FPR3757  EYPTIKNASIPTLTLANNIHPLIATVLSVIMLAVMYNTILGLMYSFAARFTEPYSKNYHI
                    ************************************************************

    COL             FIIIMMVAGYLLSFVGFAELINKLYTIMGYVGLFIVVAVIIKYFKRKNADKKHIA
    N315            FIIIMMVAGYLLSFVGFAELINKLYTIMGYVGLFIVVAVIIKYFKRKNADKKHIA
    NCTC8325        FIIIMMVAGYLLSFVGFAELINKLYTIMGYVGLFIVVAVIIKYFKRKNADKKHIA
    Newman          FIIIMMVAGYLLSFVGFAELINKLYTIMGYVGLFIVVAVIIKYFKRKNADKKHIA
    USA300_FPR3757  FIIIMMVAGYLLSFVGFAELINKLYTIMGYVGLFIVVAVIIKYFKRKNADKKHIA
                    *******************************************************