Due to technical reasons this service will not be available for 7 days from 27 Nov to 04 Dec 2017
From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002536000
  • symbol?:
  • description?: acetyltransferase

      descriptions from strain specific annotations:

    • acetyltransferase
    • Acetyltransferase GNAT family
    • acetyltransferase (GNAT) family protein
    • acetyltransferase family protein
    • GNAT family acetyltransferase
    • putative acetyltransferase
    • acetyltransferase, gnat family
  • strand?: -
  • coordinates?: 3047587..3048093
  • synteny block?: BlockID0017720
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0633
    08BA02176:
    C248_0741
    11819-97:
    MS7_0707
    71193:
    ST398NM01_0735
    ECT-R 2:
    ECTR2_608
    ED133:
    SAOV_0691c
    ED98:
    SAAV_0619
    HO 5096 0412:
    SAEMRSA15_05830
    JH1:
    SaurJH1_0695
    JH9:
    SaurJH9_0680
    JKD6008:
    SAA6008_00673
    JKD6159:
    SAA6159_00611
    LGA251:
    SARLGA251_05900
    M013:
    M013TW_0644
    MRSA252:
    SAR0667
    MSHR1132:
    SAMSHR1132_06030
    MSSA476:
    SAS0622
    Mu3:
    SAHV_0654
    Mu50:
    SAV0657
    MW2:
    MW0619
    RF122:
    SAB0606c
    ST398:
    SAPIG0735
    T0131:
    SAT0131_00727
    TCH60:
    HMPREF0772_12531
    TW20:
    SATW20_07320
    USA300_TCH1516:
    USA300HOU_0678
    VC40:
    SAVC_02915

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MAHIIRRVSIKDVENFISMLANIYDESPYMFYTPGEYDPSVTSASKQLEEYITSPHKVIF
    N315            MAHIIRRVSIKDVENFISMLAKIYDESPYMFYTPGEYDPSVTSASKQLEEYITSPHKVIF
    NCTC8325        MAHIIRRVSIKDVENFISMLANIYDESPYMFYTPGEYDPSVTSASKQLEEYITSPHKVIF
    Newman          MAHIIRRVSIKDVENFISMLANIYDESPYMFYTPGEYDPSVTSASKQLEEYITSPHKVIF
    USA300_FPR3757  MAHIIRRVSIKDVENFISMLANIYDESPYMFYTPGEYDPSVTSASKQLEEYITSPHKVIF
                    *********************:**************************************

    COL             VAESDEQLVGFAFVNTTPFQRIKHVAKIDLGVKKLYQHRGIGQALLDAIMAWCLNNQIHR
    N315            VAESDEQLVGFAFVNTTPFQRIKHVAKIDLGVKKLYQHRGIGQALLDAIMAWCLNNQIHR
    NCTC8325        VAESDEQLVGFAFVNTTPFQRIKHVAKIDLGVKKLYQHRGIGQALLDAIMAWCLNNQIHR
    Newman          VAESDEQLVGFAFVNTTPFQRIKHVAKIDLGVKKLYQHRGIGQALLDAIMAWCLNNQIHR
    USA300_FPR3757  VAESDEQLVGFAFVNTTPFQRIKHVAKIDLGVKKLYQHRGIGQALLDAIMAWCLNNQIHR
                    ************************************************************

    COL             IEANVPLNNQPALELFKSADFQIEGVLKDKLFIDGKYYDDYMMAKILN
    N315            IEANVPLNNQPALELFKSADFQIEGVLKDKLFIDGKYYDDYMMAKILN
    NCTC8325        IEANVPLNNQPALELFKSADFQIEGVLKDKLFIDGKYYDDYMMAKILN
    Newman          IEANVPLNNQPALELFKSADFQIEGVLKDKLFIDGKYYDDYMMAKILN
    USA300_FPR3757  IEANVPLNNQPALELFKSADFQIEGVLKDKLFIDGKYYDDYMMAKILN
                    ************************************************