From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002540000
  • symbol?: vraF
  • description?: ABC transporter ATP-binding protein

      descriptions from strain specific annotations:

    • ABC transporter ATP-binding protein
    • Bacitracin export ATP-binding protein BceA
    • ABC transporter family protein
    • antimicrobial peptide ABC transporter ATPase
    • ATP-binding ABC transport protein
    • putative ABC transporter protein
    • ABC transporter ATP-binding protein VraF
    • ABC transporter, ATP-binding protein VraF
    • Bacitracin ABC transporter ATP binding protein VraF
    • ABC superfamily ATP binding cassette transporter, ABC protein
    • Bacitracin transport ATP-binding protein
  • strand?: +
  • coordinates?: 3051000..3051761
  • synteny block?: BlockID0017760
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    SA0616 (vraF)
    NCTC8325:
    Newman:
    NWMN_0630 (vraF)
    USA300_FPR3757:
    04-02981:
    SA2981_0637 (vraF)
    08BA02176:
    C248_0745
    11819-97:
    MS7_0711
    71193:
    ST398NM01_0739
    ECT-R 2:
    ECTR2_612
    ED133:
    SAOV_0695
    ED98:
    SAAV_0623
    HO 5096 0412:
    SAEMRSA15_05870
    JH1:
    SaurJH1_0699
    JH9:
    SaurJH9_0684
    JKD6008:
    SAA6008_00677
    JKD6159:
    SAA6159_00615
    LGA251:
    SARLGA251_05940 (vraF)
    M013:
    M013TW_0648
    MRSA252:
    SAR0671
    MSHR1132:
    SAMSHR1132_06070
    MSSA476:
    SAS0626
    Mu3:
    SAHV_0658 (vraF)
    Mu50:
    SAV0661 (vraF)
    MW2:
    MW0623 (vraF)
    RF122:
    SAB0610
    ST398:
    SAPIG0739
    T0131:
    SAT0131_00731
    TCH60:
    HMPREF0772_12527
    TW20:
    SATW20_07360 (vraF)
    USA300_TCH1516:
    USA300HOU_0682 (vraF)
    VC40:
    SAVC_02935

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MAILEVKQLTKIYGTKKMAQEVLRDINMSIEEGEFIAIMGPSGSGKTTLLNVLSSIDYIS
    N315            MAILEVKQLTKIYGTKKMAQEVLRDINMSIEEGEFIAIMGPSGSGKTTLLNVLSSIDYIS
    NCTC8325        MAILEVKQLTKIYGTKKMAQEVLRDINMSIEEGEFIAIMGPSGSGKTTLLNVLSSIDYIS
    Newman          MAILEVKQLTKIYGTKKMAQEVLRDINMSIEEGEFIAIMGPSGSGKTTLLNVLSSIDYIS
    USA300_FPR3757  MAILEVKQLTKIYGTKKMAQEVLRDINMSIEEGEFIAIMGPSGSGKTTLLNVLSSIDYIS
                    ************************************************************

    COL             QGSITLKGKKLEKLSNKELSDIRKHDIGFIFQEYNLLHTLTVKENIMLPLTVQKLDKEHM
    N315            QGSITLKGKKLEKLSNKELSDIRKHDIGFIFQEYNLLHTLTVKENIMLPLTVQKLDKEHM
    NCTC8325        QGSITLKGKKLEKLSNKELSDIRKHDIGFIFQEYNLLHTLTVKENIMLPLTVQKLDKEHM
    Newman          QGSITLKGKKLEKLSNKELSDIRKHDIGFIFQEYNLLHTLTVKENIMLPLTVQKLDKEHM
    USA300_FPR3757  QGSITLKGKKLEKLSNKELSDIRKHDIGFIFQEYNLLHTLTVKENIMLPLTVQKLDKEHM
                    ************************************************************

    COL             LNRYEKVAEALNILDISDKYPSELSGGQRQRTSAARAFITLPSIIFADEPTGALDSKSTQ
    N315            LNRYEKVAEALNILDISDKYPSELSGGQRQRTSAARAFITLPSIIFADEPTGALDSKSTQ
    NCTC8325        LNRYEKVAEALNILDISDKYPSELSGGQRQRTSAARAFITLPSIIFADEPTGALDSKSTQ
    Newman          LNRYEKVAEALNILDISDKYPSELSGGQRQRTSAARAFITLPSIIFADEPTGALDSKSTQ
    USA300_FPR3757  LNRYEKVAEALNILDISDKYPSELSGGQRQRTSAARAFITLPSIIFADEPTGALDSKSTQ
                    ************************************************************

    COL             DLLKRLTRMNEAFKSTIIMVTHDPVAASYANRVVMLKDGQIFTELYQGDDDKHTFFKEII
    N315            DLLKRLTRMNEAFKSTIIMVTHDPVAASYANRVVMLKDGQIFTELYQGDDDKHTFFKEII
    NCTC8325        DLLKRLTRMNEAFKSTIIMVTHDPVAASYANRVVMLKDGQIFTELYQGDDDKHTFFKEII
    Newman          DLLKRLTRMNEAFKSTIIMVTHDPVAASYANRVVMLKDGQIFTELYQGDDDKHTFFKEII
    USA300_FPR3757  DLLKRLTRMNEAFKSTIIMVTHDPVAASYANRVVMLKDGQIFTELYQGDDDKHTFFKEII
                    ************************************************************

    COL             RVQSVLGGVNYDL
    N315            RVQSVLGGVNYDL
    NCTC8325        RVQSVLGGVNYDL
    Newman          RVQSVLGGVNYDL
    USA300_FPR3757  RVQSVLGGVNYDL
                    *************