From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002545000
  • symbol?:
  • description?: peptidase M23

      descriptions from strain specific annotations:

    • peptidase M23
    • secretory antigen SsaA-like protein
    • LysM domain-containing protein
    • CHAP domain-contain protein
    • N-acetylmuramoyl-L-alanine amidase sle1
    • ABC transporter
    • CHAP domain-containing protein
    • CHAP protein
    • Secretory antigen precursor SsaA
    • secretory antigen SsaA homologue
    • staphylococcal secretory antigen ssaA
  • strand?: -
  • coordinates?: 3058830..3059627
  • synteny block?: BlockID0017810
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0641 (ssaA)
    08BA02176:
    C248_0749
    11819-97:
    MS7_0715
    71193:
    ST398NM01_0743
    ECT-R 2:
    ECTR2_616
    ED133:
    SAOV_0699c
    ED98:
    SAAV_0627
    HO 5096 0412:
    SAEMRSA15_05910
    JH1:
    SaurJH1_0704
    JH9:
    SaurJH9_0689
    JKD6008:
    SAA6008_00681
    JKD6159:
    SAA6159_00619
    LGA251:
    SARLGA251_05980
    M013:
    M013TW_0652
    MRSA252:
    SAR0675
    MSHR1132:
    SAMSHR1132_06110
    MSSA476:
    SAS0630
    Mu3:
    SAHV_0662
    Mu50:
    SAV0665
    MW2:
    MW0627
    RF122:
    SAB0614c
    ST398:
    SAPIG0743
    T0131:
    SAT0131_00735
    TCH60:
    HMPREF0772_12523 (amiD7)
    TW20:
    SATW20_07400
    USA300_TCH1516:
    USA300HOU_0686
    VC40:
    SAVC_02955

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKKLAFAITATSGAAAFLTHHDAQASTQHTVQSGESLWSIAQKYNTSVESIKQNNQLDNN
    N315            MKKLAFAITATSGAAAFLTHHDAQASTQHTVQSGESLWSIAQKYNTSVESIKQNNQLDNN
    NCTC8325        MKKLAFAITATSGAAAFLTHHDAQASTQHTVQSGESLWSIAQKYNTSVESIKQNNQLDNN
    Newman          MKKLAFAITATSGAAAFLTHHDAQASTQHTVQSGESLWSIAQKYNTSVESIKQNNQLDNN
    USA300_FPR3757  MKKLAFAITATSGAAAFLTHHDAQASTQHTVQSGESLWSIAQKYNTSVESIKQNNQLDNN
                    ************************************************************

    COL             LVFPGQVISVGGSDAQNTSNTSPQAGSASSHTVQAGESLNIIASRYGVSVDQLMAANNLR
    N315            LVFPGQVISVGGSDAQNTSNTSPQAGSASSHTVQAGESLNIIASRYGVSVDQLMAANNLR
    NCTC8325        LVFPGQVISVGGSDAQNTSNTSPQAGSASSHTVQAGESLNIIASRYGVSVDQLMAANNLR
    Newman          LVFPGQVISVGGSDAQNTSNTSPQAGSASSHTVQAGESLNIIASRYGVSVDQLMAANNLR
    USA300_FPR3757  LVFPGQVISVGGSDAQNTSNTSPQAGSASSHTVQAGESLNIIASRYGVSVDQLMAANNLR
                    ************************************************************

    COL             GYLIMPNQTLQIPNGGSGGTTPTATTGSNGNASSFNHQNLYTAGQCTWYVFDRRAQAGSP
    N315            GYLIMPNQTLQIPNGGSGGTTPTATTGSNGNASSFNHQNLYTAGQCTWYVFDRRAQAGSP
    NCTC8325        GYLIMPNQTLQIPNGGSGGTTPTATTGSNGNASSFNHQNLYTAGQCTWYVFDRRAQAGSP
    Newman          GYLIMPNQTLQIPNGGSGGTTPTATTGSNGNASSFNHQNLYTAGQCTWYVFDRRAQAGSP
    USA300_FPR3757  GYLIMPNQTLQIPNGGSGGTTPTATTGSNGNASSFNHQNLYTAGQCTWYVFDRRAQAGSP
                    ************************************************************

    COL             ISTYWSDAKYWAGNAANDGYQVNNTPSVGSIMQSTPGPYGHVAYVERVNGDGSILISEMN
    N315            ISTYWSDAKYWAGNAANDGYQVNNTPSVGSIMQSTPGPYGHVAYVERVNGDGSILISEMN
    NCTC8325        ISTYWSDAKYWAGNAANDGYQVNNTPSVGSIMQSTPGPYGHVAYVERVNGDGSILISEMN
    Newman          ISTYWSDAKYWAGNAANDGYQVNNTPSVGSIMQSTPGPYGHVAYVERVNGDGSILISEMN
    USA300_FPR3757  ISTYWSDAKYWAGNAANDGYQVNNTPSVGSIMQSTPGPYGHVAYVERVNGDGSILISEMN
                    ************************************************************

    COL             YTYGPYNMNYRTIPASEVSSYAFIH
    N315            YTYGPYNMNYRTIPASEVSSYAFIH
    NCTC8325        YTYGPYNMNYRTIPASEVSSYAFIH
    Newman          YTYGPYNMNYRTIPASEVSSYAFIH
    USA300_FPR3757  YTYGPYNMNYRTIPASEVSSYAFIH
                    *************************