From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002547000
  • symbol?:
  • description?: AraC family transcriptional regulator

      descriptions from strain specific annotations:

    • AraC family transcriptional regulator
    • AraC family transcription regulator
    • AraC/XylS family transcriptional regulator
    • AraC family regulatory protein
    • bacterial regulatory helix-turn-helix s, AraC family protein
    • pseudogene
    • regulatory helix-turn-helix proteins, AraC family protein
    • transcriptional regulator, AraC family
    • Transcriptional regulator of biofilm formation (AraC/XylS family)
  • strand?: +
  • coordinates?: 3061759..3063783
  • synteny block?: BlockID0017830
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0643
    08BA02176:
    C248_0751
    11819-97:
    MS7_0717
    71193:
    ST398NM01_0745
    ECT-R 2:
    ECTR2_618
    ED133:
    SAOV_0701
    ED98:
    SAAV_0629
    HO 5096 0412:
    SAEMRSA15_05930
    JH1:
    SaurJH1_0706
    JH9:
    SaurJH9_0691
    JKD6008:
    SAA6008_00683
    JKD6159:
    SAA6159_00621
    LGA251:
    SARLGA251_06000
    M013:
    M013TW_0654
    MRSA252:
    SAR0677
    MSHR1132:
    SAMSHR1132_06130
    MSSA476:
    SAS0632
    Mu3:
    SAHV_0664
    Mu50:
    SAV0667
    MW2:
    MW0629
    RF122:
    SAB0616
    ST398:
    SAPIG0745
    T0131:
    SAT0131_00737
    TCH60:
    HMPREF0772_12521
    TW20:
    SATW20_07420
    USA300_TCH1516:
    USA300HOU_0688
    VC40:
    SAVC_02965

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MAKSCLHILTNNEYATTRCQDGIVLFWPIDGEIELQKFRKSKIIEDDIYIINHLDVFSIK
    N315            MAKSCLHILTNNEYATTRCQDGIVLFWPIDGEIELQKFRKSKIIEDDIYIINHLDVFSIK
    NCTC8325        MAKSCLHILTNNEYATTRCQDGIVLFWPIDGEIELQKFRKSKIIEDDIYIINHLDVFSIK
    Newman          MAKSCLHILTNNEYATTRCQDGIVLFWPIDGEIELQKFRKSKIIEDDIYIINHLDVFSIK
    USA300_FPR3757  MAKSCLHILTNNEYATTRCQDGIVLFWPIDGEIELQKFRKSKIIEDDIYIINHLDVFSIK
                    ************************************************************

    COL             NNKKTIMLYLSSDWFAELGFTFFNYHYTAKLIKSSYNLKCLLLKLTYRYLDNQPLNDADI
    N315            NNKKTIMLYLSSDWFAELGFTFFNYHYTAKLIKSSYNLKCLLLKLTYRYLDNQPLNDADI
    NCTC8325        NNKKTIMLYLSSDWFAELGFTFFNYHYTAKLIKSSYNLKCLLLKLTYRYLDNQPLNDADI
    Newman          NNKKTIMLYLSSDWFAELGFTFFNYHYTAKLIKSSYNLKCLLLKLTYRYLDNQPLNDADI
    USA300_FPR3757  NNKKTIMLYLSSDWFAELGFTFFNYHYTAKLIKSSYNLKCLLLKLTYRYLDNQPLNDADI
                    ************************************************************

    COL             RKLQDIIKIIAKEASMDKKIAQNQYRYAYYGDLRDELEYIYQNVNQRLTLKSVADKLFVS
    N315            RKLQDIIKIIAKEASMDKKIAQNQYRYAYYGDLRDELEYIYQNVNQRLTLKSVADKLFVS
    NCTC8325        RKLQDIIKIIAKEASMDKKIAQNQYRYAYYGDLRDELEYIYQNVNQRLTLKSVADKLFVS
    Newman          RKLQDIIKIIAKEASMDKKIAQNQYRYAYYGDLRDELEYIYQNVNQRLTLKSVADKLFVS
    USA300_FPR3757  RKLQDIIKIIAKEASMDKKIAQNQYRYAYYGDLRDELEYIYQNVNQRLTLKSVADKLFVS
                    ************************************************************

    COL             KSNLSSQFHLLMGMGFKKYIDTLKIGKSIEILLTTDSTISNISEHLGFSSSSTYSKMFKS
    N315            KSNLSSQFHLLMGMGFKKYIDTLKIGKSIEILLTTDSTISNISEHLGFSSSSTYSKMFKS
    NCTC8325        KSNLSSQFHLLMGMGFKKYIDTLKIGKSIEILLTTDSTISNISEHLGFSSSSTYSKMFKS
    Newman          KSNLSSQFHLLMGMGFKKYIDTLKIGKSIEILLTTDSTISNISEHLGFSSSSTYSKMFKS
    USA300_FPR3757  KSNLSSQFHLLMGMGFKKYIDTLKIGKSIEILLTTDSTISNISEHLGFSSSSTYSKMFKS
                    ************************************************************

    COL             YMDITPNEYRNLSKYNKCLMLKPEPLVGKMVQEVKEIILNYIEHYKNHLTDVIHIDEDKF
    N315            YMDITPNEYRNLSKYNKCLMLKPEPLVGKMVQEVKEIILNYIEHYKNHLTDVIHIDEDKF
    NCTC8325        YMDITPNEYRNLSKYNKCLMLKPEPLVGKMVQEVKEIILNYIEHYKNHLTDVIHIDEDKF
    Newman          YMDITPNEYRNLSKYNKCLMLKPEPLVGKMVQEVKEIILNYIEHYKNHLTDVIHIDEDKF
    USA300_FPR3757  YMDITPNEYRNLSKYNKCLMLKPEPLVGKMVQEVKEIILNYIEHYKNHLTDVIHIDEDKF
                    ************************************************************

    COL             ETPKLFQTVIQINTYTEMKLVFLEGIFKTLLNKNSQVVFFIMPSILKSKNTMSEEEKFTI
    N315            ETPKLFQTVIQINTYTEMKLVFLEGIFKTLLNKNSQVVFFIMPSILKSKNTMSEEEKFTI
    NCTC8325        ETPKLFQTVIQINTYTEMKLVFLEGIFKTLLNKNSQVVFFIMPSILKSKNTMSEEEKFTI
    Newman          ETPKLFQTVIQINTYTEMKLVFLEGIFKTLLNKNSQVVFFIMPSILKSKNTMSEEEKFTI
    USA300_FPR3757  ETPKLFQTVIQINTYTEMKLVFLEGIFKTLLNKNSQVVFFIMPSILKSKNTMSEEEKFTI
                    ************************************************************

    COL             IKTIIESDLKIAFNINNIETTYFVEEAFMSVFRQISPNELSNHNNYEVHFVFDLSLMEIR
    N315            IKTIIESDLKIAFNINDIETTYFVEEAFMSVFRQISPNELSNHNNYEVHFVFDLSLMEIR
    NCTC8325        IKTIIESDLKIAFNINNIETTYFVEEAFMSVFRQISPNELSNHNNYEVHFVFDLSLMEIR
    Newman          IKTIIESDLKIAFNINNIETTYFVEEAFMSVFRQISPNELSNHNNYEVHFVFDLSLMEIR
    USA300_FPR3757  IKTIIESDLKIAFNINNIETTYFVEEAFMSVFRQISPNELSNHNNYEVHFVFDLSLMEIR
                    ****************:*******************************************

    COL             TIYRMILKLHNIMLNVKLGLNITCLFEKPSVFKSLVSQIKRLKFDSLIIDNANLSSPYLM
    N315            TIYRMILKLHNIMLNVKLGLNITCLFEKPSVFKSLVSQIKRLKFDSLIIDNANLSSPYLM
    NCTC8325        TIYRMILKLHNIMLNVKLGLNITCLFEKPSVFKSLVSQIKRLKFDSLIIDNANLSSPYLM
    Newman          TIYRMILKLHNIMLNVKLGLNITCLFEKPSVFKSLVSQIKRLKFDSLIIDNANLSSPYLM
    USA300_FPR3757  TIYRMILKLHNIMLNVKLGLNITCLFEKPSVFKSLVSQIKRLKFDSLIIDNANLSSPYLM
                    ************************************************************

    COL             GESDELLLKNILHFKNLKQVINELDIEQEKLIFLNVENHKLLNNKERDLSNSAPLIYKTL
    N315            GESDELLLKNILHFKNLKQVINELDIEQEKLIFLNVENHKLLNNKERDLSNSAPLIYKTL
    NCTC8325        GESDELLLKNILHFKNLKQVINELDIEQEKLIFLNVENHKLLNNKERDLSNSAPLIYKTL
    Newman          GESDELLLKNILHFKNLKQVINELDIEQEKLIFLNVENHKLLNNKERDLSNSAPLIYKTL
    USA300_FPR3757  GESDELLLKNILHFKNLKQVINELDIEQEKLIFLNVENHKLLNNKERDLSNSAPLIYKTL
                    ************************************************************

    COL             SALYHNFDGFGLNIFDNHQAFNAMHLYDKNGFKTTLGLILEKFIEYVSKPKYENSYYSIF
    N315            SALYHNFDGFGLNIFDNHHTFNAMHLYDKNGFKTTLGLILEKFIEYVSKPKYENSYYSIF
    NCTC8325        SALYHNFDGFGLNIFDNHQAFNAMHLYDKNGFKTTLGLILEKFIEYVSKPKYENSYYSIF
    Newman          SALYHNFDGFGLNIFDNHQAFNAMHLYDKNGFKTTLGLILEKFIEYVSKPKYENSYYSIF
    USA300_FPR3757  SALYHNFDGFGLNIFDNHQAFNAMHLYDKNGFKTTLGLILEKFIEYVSKPKYENSYYSIF
                    ******************::****************************************

    COL             DIENYYCLVIYDWRVIESETIMSNFEDSQVYINFKNNVLNDKYLIVIETLDENSGNINHL
    N315            DIENYYCLVIYDWRVIESETIMSNFEDSQVYINFKNNVLNDKYLIVIETLDENSGNINHL
    NCTC8325        DIENYYCLVIYDWRVIESETIMSNFEDSQVYINFKNNVLNDKYLIVIETLDENSGNINHL
    Newman          DIENYYCLVIYDWRVIESETIMSNFEDSQVYINFKNNVLNDKYLIVIETLDENSGNINHL
    USA300_FPR3757  DIENYYCLVIYDWRVIESETIMSNFEDSQVYINFKNNVLNDKYLIVIETLDK--------
                    ***************************************************:        

    COL             ISKELRDKYEWNPSLLSKIDNYLKPAIEIKEHNFSDNSLNINVTFNALYIIKIGKK
    N315            ISKELRDKYEWNPSLLSKIDNYLKPAIEIKEHNFSDNSLNINVTFNALYIIKIGKK
    NCTC8325        ISKELRDKYEWNPSLLSKIDNYLKPAIEIKEHNFSDNSLNINVTFNALYIIKIGKK
    Newman          ISKELRDKYEWNPSLLSKIDNYLKPAIEIKEHNFSDNSLNINVTFNALYIIKIGKK
    USA300_FPR3757  --------------------------------------------IVATLII-----
                                                                : *  **