From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002548000
  • symbol?: sarX
  • description?: accessory regulator A-like protein

      descriptions from strain specific annotations:

    • accessory regulator A-like protein
    • HTH-type transcriptional regulator SarX
    • staphylococcal accessory regulator protein X
    • staphylococcal accessory protein X
    • HTH-type transcriptional regulator SarX (Staphylococcal accessoryregulator X)
  • strand?: +
  • coordinates?: 3064021..3064458
  • synteny block?: BlockID0017840
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0726 (sarX)
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0644
    08BA02176:
    C248_0752
    11819-97:
    MS7_0718 (sarX)
    71193:
    ST398NM01_0746
    ECT-R 2:
    ECTR2_619
    ED133:
    SAOV_0702
    ED98:
    SAAV_0630 (sarX)
    HO 5096 0412:
    SAEMRSA15_05940
    JH1:
    SaurJH1_0707
    JH9:
    SaurJH9_0692
    JKD6008:
    SAA6008_00684 (sarX)
    JKD6159:
    SAA6159_00622 (sarX)
    LGA251:
    SARLGA251_06010 (sarX)
    M013:
    M013TW_0655
    MRSA252:
    SAR0679
    MSHR1132:
    SAMSHR1132_06140
    MSSA476:
    SAS0633
    Mu3:
    SAHV_0665
    Mu50:
    SAV0668
    MW2:
    MW0630
    RF122:
    SAB0617
    ST398:
    SAPIG0746
    T0131:
    SAT0131_00738
    TCH60:
    HMPREF0772_12520 (sarX)
    TW20:
    SATW20_07430 (sarX)
    USA300_TCH1516:
    USA300HOU_0689 (sarX)
    VC40:
    SAVC_02970

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MAEKFKIIMTEALSLYIWGCNILNTEKLETLLGFYKQYKALSEYIDKKYKLSLNDLAVLD
    N315            MAKKFKIIMTEALSLYIWGCNILNTEKLETLLGFYKQYKALSEYIDKKYKLSLNDLAVLD
    NCTC8325        MAEKFKIIMTEALSLYIWGCNILNTEKLETLLGFYKQYKALSEYIDKKYKLSLNDLAVLD
    Newman          MAEKFKIIMTEALSLYIWGCNILNTEKLETLLGFYKQYKALSEYIDKKYKLSLNDLAVLD
    USA300_FPR3757  MAEKFKIIMTEALSLYIWGCNILNTEKLETLLGFYKQYKALSEYIDKKYKLSLNDLAVLD
                    **:*********************************************************

    COL             LTMKHCKDEKVLMQSFLKTAMDELDLSRTKLLVSIRRLIEKERLSKVRSSKDERKIYIYL
    N315            LTMKHCKDEKVLMQSFLKTAMDELDLSRTKLLVSIRRLIEKERLSKVRSSKDERKIYIYL
    NCTC8325        LTMKHCKDEKVLMQSFLKTAMDELDLSRTKLLVSIRRLIEKERLSKVRSSKDERKIYIYL
    Newman          LTMKHCKDEKVLMQSFLKTAMDELDLSRTKLLVSIRRLIEKERLSKVRSSKDERKIYIYL
    USA300_FPR3757  LTMKHCKDEKVLMQSFLKTAMDELDLSRTKLLVSIRRLIEKERLSKVRSSKDERKIYIYL
                    ************************************************************

    COL             NNDDISKFNALFEDVEQFLNI
    N315            NNDDISKFNALFEDVEQFLNI
    NCTC8325        NNDDISKFNALFEDVEQFLNI
    Newman          NNDDISKFNALFEDVEQFLNI
    USA300_FPR3757  NNDDISKFNALFEDVEQFLNI
                    *********************