From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002550000
  • symbol?:
  • description?: cupin

      descriptions from strain specific annotations:

    • cupin
    • cupin superfamily protein
  • strand?: +
  • coordinates?: 3065367..3065840
  • synteny block?: BlockID0017860
  • occurrence?: in 88% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    08BA02176:
    C248_0754
    11819-97:
    MS7_0720
    71193:
    ST398NM01_0748
    ECT-R 2:
    ECTR2_621
    ED133:
    SAOV_0704
    ED98:
    SAAV_0632
    HO 5096 0412:
    SAEMRSA15_05960
    JH1:
    SaurJH1_0709
    JH9:
    SaurJH9_0694
    JKD6008:
    SAA6008_00686
    JKD6159:
    SAA6159_00624
    LGA251:
    SARLGA251_06030
    M013:
    M013TW_0657
    MRSA252:
    SAR0681
    MSHR1132:
    SAMSHR1132_06160
    MSSA476:
    SAS0635
    Mu3:
    Mu50:
    MW2:
    MW0632
    RF122:
    SAB0619
    ST398:
    SAPIG0748
    T0131:
    SAT0131_00740
    TCH60:
    HMPREF0772_12518
    TW20:
    SATW20_07450
    USA300_TCH1516:
    USA300HOU_0691
    VC40:
    SAVC_02980

Genome Viewer[edit source | edit]

COL chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKSAEQWIDELQLESHPEGGFYRETIREVLKDGRRAPFSSIYFLLTDDNISHFHRIDADE
    NCTC8325        MKSAEQWIDELQLESHPEGGFYRETIREVLKDGRRAPFSSIYFLLTDDNISHFHRIDADE
    Newman          MKSAEQWIDELQLESHPEGGFYRETIREVLKDGRRAPFSSIYFLLTDDNISHFHRIDADE
    USA300_FPR3757  MKSAEQWIDELQLESHPEGGFYRETIREVLKDGRRAPFSSIYFLLTDDNISHFHRIDADE
                    ************************************************************

    COL             VWYYHAGDSLTIHMINPDGEYTTATLGTDIQNGDVLQYVVPKGTIFASSIEISNTFSLVG
    NCTC8325        VWYYHAGDSLTIHMINPDGEYTTATLGTDIQNGDVLQYVVPKGTIFASSIEISNTFSLVG
    Newman          VWYYHAGDSLTIHMINPDGEYTTATLGTDIQNGDVLQYVVPKGTIFASSIEISNTFSLVG
    USA300_FPR3757  VWYYHAGDSLTIHMINPDGEYTTATLGTDIQNGDVLQYVVPKGTIFASSIEISNTFSLVG
                    ************************************************************

    COL             CMCQPAFEFKQFELFKQSELITQYPHLKSVIEKYALK
    NCTC8325        CMCQPAFEFKQFELFKQSELITQYPHLKSVIEKYALK
    Newman          CMCQPAFEFKQFELFKQSELITQYPHLKSVIEKYALK
    USA300_FPR3757  CMCQPAFEFKQFELFKQSELITQYPHLKSVIEKYALK
                    *************************************