From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002554000
  • symbol?: ccpE
  • description?: LysR family transcriptional regulator

      descriptions from strain specific annotations:

    • LysR family transcriptional regulator
    • LysR family regulatory protein
    • bacterial regulatory helix-turn-helix , lysR family protein
    • hydrogen peroxide-inducible genes activator
    • LysR substrate-binding
    • regulatory helix-turn-helix protein, lysR family protein
  • strand?: +
  • coordinates?: 3067332..3068223
  • synteny block?: BlockID0017900
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0649 (lysR)
    08BA02176:
    C248_0757
    11819-97:
    MS7_0723
    71193:
    ST398NM01_0750
    ECT-R 2:
    ECTR2_624
    ED133:
    SAOV_0707
    ED98:
    SAAV_0635
    HO 5096 0412:
    SAEMRSA15_05980
    JH1:
    SaurJH1_0712
    JH9:
    SaurJH9_0696
    JKD6008:
    SAA6008_00689
    JKD6159:
    SAA6159_00626
    LGA251:
    SARLGA251_06050
    M013:
    M013TW_0659
    MRSA252:
    SAR0683
    MSHR1132:
    SAMSHR1132_06180
    MSSA476:
    SAS0637
    Mu3:
    SAHV_0669
    Mu50:
    SAV0672
    MW2:
    MW0634
    RF122:
    SAB0621
    ST398:
    SAPIG0750
    T0131:
    SAT0131_00743
    TCH60:
    HMPREF0772_12516
    TW20:
    SATW20_07470
    USA300_TCH1516:
    USA300HOU_0694
    VC40:
    SAVC_02990

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKIEDYRLLITLDETKTLRKAAEILYISQPAVTQRLKAIENAFGVDIFIRTKKQLITTTE
    N315            ------------------------------------------------------------
    NCTC8325        MKIEDYRLLITLDETKTLRKAAEILYISQPAVTQRLKAIENAFGVDIFIRTKKQLITTTE
    Newman          MKIEDYRLLITLDETKTLRKAAEILYISQPAVTQRLKAIENAFGVDIFIRTKKQLITTTE
    USA300_FPR3757  MKIEDYRLLITLDETKTLRKAAEILYISQPAVTQRLKAIENAFGVDIFIRTKKQLITTTE
                                                                                

    COL             GTMIIEHARDMLKRERLFFDKMQAHIGEVNGTISIGCSSLIGQTLLPEVLSLYNAQFPNV
    N315            --MIIEHARDMLKRERLFFDKMQAHIGEVNGTISIGCSSLIGQTLLPEVLSLYNAQFPNV
    NCTC8325        GTMIIEHARDMLKRERLFFDKMQAHIGEVNGTISIGCSSLIGQTLLPEVLSLYNAQFPNV
    Newman          GTMIIEHARDMLKRERLFFDKMQAHIGEVNGTISIGCSSLIGQTLLPEVLSLYNAQFPNV
    USA300_FPR3757  GTMIIEHARDMLKRERLFFDKMQAHIGEVNGTISIGCSSLIGQTLLPEVLSLYNAQFPNV
                      **********************************************************

    COL             EIQVQVGSTEQIKANHRDYHVMITRGNKVMNLANTHLFNDDHYFIFPKNRRDDVTKLPFI
    N315            EIQVQVGSTEQIKANHRDYHVMITRGNKVMNLANTHLFNDDHYFIFPKNRRDDVTKLPFI
    NCTC8325        EIQVQVGSTEQIKANHRDYHVMITRGNKVMNLANTHLFNDDHYFIFPKNRRDDVTKLPFI
    Newman          EIQVQVGSTEQIKANHRDYHVMITRGNKVMNLANTHLFNDDHYFIFPKNRRDDVTKLPFI
    USA300_FPR3757  EIQVQVGSTEQIKANHRDYHVMITRGNKVMNLANTHLFNDDHYFIFPKNRRDDVTKLPFI
                    ************************************************************

    COL             EFQADPIYINQIKEWYNDNLEQDYHATITVDQVATCKEMLISGVGVTILPEIMMKNISKE
    N315            EFQADPIYINQIKQWYNDNLEQDYHATITVDQVATCKEMLISGVGVTILPEIMMKNISKE
    NCTC8325        EFQADPIYINQIKEWYNDNLEQDYHATITVDQVATCKEMLISGVGVTILPEIMMKNISKE
    Newman          EFQADPIYINQIKEWYNDNLEQDYHATITVDQVATCKEMLISGVGVTILPEIMMKNISKE
    USA300_FPR3757  EFQADPIYINQIKEWYNDNLEQDYHATITVDQVATCKEMLISGVGVTILPEIMMKNISKE
                    *************:**********************************************

    COL             QFEFEKVEIDNEPLIRSTFMSYDPSMLQLPQVDSFVNLMASFVEQPKA
    N315            QFEFEKVEIDNEPLIRSTFMSYDPSMLQLPQVDSFVNLMASFVEQPKA
    NCTC8325        QFEFEKVEIDNEPLIRSTFMSYDPSMLQLPQVDSFVNLMASFVEQPKA
    Newman          QFEFEKVEIDNEPLIRSTFMSYDPSMLQLPQVDSFVNLMASFVEQPKA
    USA300_FPR3757  QFEFEKVEIDNEPLIRSTFMSYDPSMLQLPQVDSFVNLMASFVEQPKA
                    ************************************************