From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002556000
  • symbol?:
  • description?: MFS transporter

      descriptions from strain specific annotations:

    • MFS transporter
    • sugar efflux transporter
    • major facilitator superfamily protein superfamily
    • major facilitator superfamily protein
    • major facilitator superfamily sugar:cation symporter
    • major facilitator transporter
    • MFS family major facilitator transporter, sugar:cation symporter
    • putative sugar efflux transporter
    • sugar efflux transporter, putative
    • sugar efflux transpoter
  • strand?: +
  • coordinates?: 3068843..3070435
  • synteny block?: BlockID0017920
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0650
    08BA02176:
    C248_0758
    11819-97:
    MS7_0725
    71193:
    ST398NM01_0751
    ECT-R 2:
    ECTR2_625
    ED133:
    SAOV_0708
    ED98:
    SAAV_0636
    HO 5096 0412:
    SAEMRSA15_05990
    JH1:
    SaurJH1_0713
    JH9:
    SaurJH9_0697
    JKD6008:
    SAA6008_00690
    JKD6159:
    SAA6159_00628
    LGA251:
    SARLGA251_06060
    M013:
    M013TW_0660
    MRSA252:
    SAR0684
    MSHR1132:
    SAMSHR1132_06190
    MSSA476:
    SAS0638
    Mu3:
    SAHV_0670
    Mu50:
    SAV0673
    MW2:
    MW0635
    RF122:
    SAB0622
    ST398:
    SAPIG0751
    T0131:
    SAT0131_00744
    TCH60:
    HMPREF0772_12515
    TW20:
    SATW20_07480
    USA300_TCH1516:
    USA300HOU_0696
    VC40:
    SAVC_02995

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MDMFAALLQIKNYKLFVANMFLLGMGIAVTVPYLVLFATKDLGMTTNQYGLLLASAAISQ
    N315            --MFAALLQIKNYKLFVANMFLLGMGIAVTVPYLVLFATKDLGMTTNQYGLLLASAAISQ
    NCTC8325        MDMFAALLQIKNYKLFVANMFLLGMGIAVTVPYLVLFATKDLGMTTNQYGLLLASAAISQ
    Newman          MDMFAALLQIKNYKLFVANMFLLGMGIAVTVPYLVLFATKDLGMTTNQYGLLLASAAISQ
    USA300_FPR3757  MDMFAALLQIKNYKLFVANMFLLGMGIAVTVPYLVLFATKDLGMTTNQYGLLLASAAISQ
                      **********************************************************

    COL             FTVNSIIARFSDTHHFNRKIIIILALLMGALGFSIYFFVDTIWLFILLYAIFQGLFAPAM
    N315            FTVNSIIARFSDTHHFNRKIIIILALLMGALGFSIYFFVDTIWLFILLYAIFQGLFAPAM
    NCTC8325        FTVNSIIARFSDTHHFNRKIIIILALLMGALGFSIYFFVDTIWLFILLYAIFQGLFAPAM
    Newman          FTVNSIIARFSDTHHFNRKIIIILALLMGALGFSIYFFVDTIWLFILLYAIFQGLFAPAM
    USA300_FPR3757  FTVNSIIARFSDTHHFNRKIIIILALLMGALGFSIYFFVDTIWLFILLYAIFQGLFAPAM
                    ************************************************************

    COL             PQLYASARESINVSSSKDRAQFANTVLRSMFSLGFLFGPFIGAQLIGLKGYAGLFGGTIS
    N315            PQLYASARESINVSSSKDRAQFANTVLRSMFSLGFLFGPFIGAQLIGLKGYAGLFGGTIS
    NCTC8325        PQLYASARESINVSSSKDRAQFANTVLRSMFSLGFLFGPFIGAQLIGLKGYAGLFGGTIS
    Newman          PQLYASARESINVSSSKDRAQFANTVLRSMFSLGFLFGPFIGAQLIGLKGYAGLFGGTIS
    USA300_FPR3757  PQLYASARESINVSSSKDRAQFANTVLRSMFSLGFLFGPFIGAQLIGLKGYAGLFGGTIS
                    ************************************************************

    COL             IILFTLVLQVFFYKDLNIKHPISTQQHVEKIAPNMFKDKTLLLPFIAFILLHIGQWMYTM
    N315            IILFTLVLQVFFYKDLNIKHPISTQQHVEKIAPNMFKDKTLLLPFIAFILLHIGQWMYTM
    NCTC8325        IILFTLVLQVFFYKDLNIKHPISTQQHVEKIAPNMFKDKTLLLPFIAFILLHIGQWMYTM
    Newman          IILFTLVLQVFFYKDLNIKHPISTQQHVEKIAPNMFKDKTLLLPFIAFILLHIGQWMYTM
    USA300_FPR3757  IILFTLVLQVFFYKDLNIKHPISTQQHVEKIAPNMFKDKTLLLPFIAFILLHIGQWMYTM
                    ************************************************************

    COL             NMPLFVTDYLKENEQHVGYLASLCAGLEVPFMIILGVLSSRLQTRTLLIYGAIFGGLFYF
    N315            NMPLFVTDYLKENEQHVGYLASLCAGLEVPFMIILGVLSSRLHTRTLLIYGAIFGGLFYF
    NCTC8325        NMPLFVTDYLKENEQHVGYLASLCAGLEVPFMIILGVLSSRLQTRTLLIYGAIFGGLFYF
    Newman          NMPLFVTDYLKENEQHVGYLASLCAGLEVPFMIILGVLSSRLQTRTLLIYGAIFGGLFYF
    USA300_FPR3757  NMPLFVTDYLKENEQHVGYLASLCAGLEVPFMIILGVLSSRLQTRTLLIYGAIFGGLFYF
                    ******************************************:*****************

    COL             SIGVFKNFYMMLAGQVFLAIFLAVLLGIGISYFQDILPDFPGYASTLFSNAMVIGQLGGN
    N315            SIGVFKNFYMMLAGQVFLAIFLAVLLGIGISYFQDILPDFPGYASTLFSNAMVIGQLGGN
    NCTC8325        SIGVFKNFYMMLAGQVFLAIFLAVLLGIGISYFQDILPDFPGYASTLFSNAMVIGQLGGN
    Newman          SIGVFKNFYMMLAGQVFLAIFLAVLLGIGISYFQDILPDFPGYASTLFSNAMVIGQLGGN
    USA300_FPR3757  SIGVFKNFYMMLAGQVFLAIFLAVLLGIGISYFQDILPDFPGYASTLFSNAMVIGQLGGN
                    ************************************************************

    COL             LLGGAMSHWVGLENVFFVSAASIMLGMILIFFTKNQKITKEDVIST
    N315            LLGGAMSHWVGLENVFFVSAASIMLGMILIFFTKNQKITKEDMIST
    NCTC8325        LLGGAMSHWVGLENVFFVSAASIMLGMILIFFTKNQKITKEDVIST
    Newman          LLGGAMSHWVGLENVFFVSAASIMLGMILIFFTKNQKITKEDVIST
    USA300_FPR3757  LLGGAMSHWVGLENVFFVSAASIMLGMILIFFTKNQKITKEDVIST
                    ******************************************:***