From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002562000
  • symbol?:
  • description?: hypothetical protein
  • strand?: +
  • coordinates?: 3074632..3074931
  • synteny block?: BlockID0017980
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0655
    08BA02176:
    C248_0763
    11819-97:
    MS7_0730
    71193:
    ST398NM01_0756
    ECT-R 2:
    ECTR2_630
    ED133:
    SAOV_0713
    ED98:
    SAAV_0641
    HO 5096 0412:
    SAEMRSA15_06040
    JH1:
    SaurJH1_0718
    JH9:
    SaurJH9_0702
    JKD6008:
    SAA6008_00695
    JKD6159:
    SAA6159_00633
    LGA251:
    SARLGA251_06110
    M013:
    M013TW_0665
    MRSA252:
    SAR0731
    MSHR1132:
    SAMSHR1132_06240
    MSSA476:
    SAS0643
    Mu3:
    SAHV_0675
    Mu50:
    SAV0678
    MW2:
    MW0640
    RF122:
    SAB0627
    ST398:
    SAPIG0756
    T0131:
    SAT0131_00749
    TCH60:
    HMPREF0772_12509
    TW20:
    SATW20_07530
    USA300_TCH1516:
    USA300HOU_0701
    VC40:
    SAVC_03020

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MHEQDFRILEGQDITLPELGRELENITGHTIADSTGEIKRVIAHLPNFESDTDTFVATYR
    N315            MHEQDFRILEGQDITLPELGRELENITGHTIADSTGEIKRVIAHLPNFESDTDTFVATYR
    NCTC8325        MHEQDFRILEGQDITLPELGRELENITGHTIADSTGEIKRVIAHLPNFESDTDTFVATYR
    Newman          MHEQDFRILEGQDITLPELGRELENITGHTIADSTGEIKRVIAHLPNFESDTDTFVATYR
    USA300_FPR3757  MHEQDFRILEGQDITLPELGRELENITGHTIADSTGEIKRVIAHLPNFESDTDTFVATYR
                    ************************************************************

    COL             LNHQQDFIDATFTALKSDRARLKEVPVHVELISYISKSK
    N315            LNHQQDFIDATFTALKSDRARLKEVPVHVELISYISKSK
    NCTC8325        LNHQQDFIDATFTALKSDRARLKEVPVHVELISYISKSK
    Newman          LNHQQDFIDATFTALKSDRARLKEVPVHVELISYISKSK
    USA300_FPR3757  LNHQQDFIDATFTALKSDRARLKEVPVHVELISYISKSK
                    ***************************************