From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002563000
  • symbol?:
  • description?: N-acetyltransferase GCN5

      descriptions from strain specific annotations:

    • N-acetyltransferase GCN5
    • Acetyltransferase GNAT family
    • acetyltransferase (GNAT) family protein
    • GNAT family acetyltransferase
    • putative acetyltransferase
    • acetyltransferase, gnat family
    • ribosomal-protein-alanine acetyltransferase
    • acetyltransferase family protein
  • strand?: +
  • coordinates?: 3075013..3075555
  • synteny block?: BlockID0017990
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0656
    08BA02176:
    C248_0764
    11819-97:
    MS7_0731
    71193:
    ST398NM01_0757
    ECT-R 2:
    ECTR2_631
    ED133:
    SAOV_0714
    ED98:
    SAAV_0642
    HO 5096 0412:
    SAEMRSA15_06050
    JH1:
    SaurJH1_0719
    JH9:
    SaurJH9_0703
    JKD6008:
    SAA6008_00696 (rimL)
    JKD6159:
    SAA6159_00634 (rimL)
    LGA251:
    SARLGA251_06120
    M013:
    M013TW_0666
    MRSA252:
    SAR0732
    MSHR1132:
    SAMSHR1132_06250
    MSSA476:
    SAS0644
    Mu3:
    SAHV_0676
    Mu50:
    SAV0679
    MW2:
    MW0641
    RF122:
    SAB0628
    ST398:
    SAPIG0757
    T0131:
    SAT0131_00750
    TCH60:
    HMPREF0772_12508
    TW20:
    SATW20_07540
    USA300_TCH1516:
    USA300HOU_0702
    VC40:
    SAVC_03025

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MIYCETERLILRDWHEDDLLPFQKMNANYDVRKYFPSLLSYRRSELDMRTMDAVIKDYGI
    N315            MIYCETERLILRDWHEDDLLPFQKMNANYDVRKYFPSLLSYRRSELDMRTMDAVIKDYGI
    NCTC8325        MIYCETERLILRDWHEDDLLPFQKMNANYDVRKYFPSLLSYRRSELDMRTMDAVIKDYGI
    Newman          MIYCETERLILRDWHEDDLLPFQKMNANYDVRKYFPSLLSYRRSELDMRTMDAVIKDYGI
    USA300_FPR3757  MIYCETERLILRDWHEDDLLPFQKMNANYDVRKYFPSLLSYRRSELDMRTMDAVIKDYGI
                    ************************************************************

    COL             GLFAVEDKESHQWIGFIGLNYIPETSDYPFKELPLYEIGWRLLPEFWGKGLATEGAKATL
    N315            GLFAVEDKESHQWIGFIGLNYIPETSDYPFKELPLYEIGWRLLPEFWGKGLATEGAKATL
    NCTC8325        GLFAVEDKESHQWIGFIGLNYIPETSDYPFKELPLYEIGWRLLPEFWGKGLATEGAKATL
    Newman          GLFAVEDKESHQWIGFIGLNYIPETSDYPFKELPLYEIGWRLLPEFWGKGLATEGAKATL
    USA300_FPR3757  GLFAVEDKESHQWIGFIGLNYIPETSDYPFKELPLYEIGWRLLPEFWGKGLATEGAKATL
                    ************************************************************

    COL             KLAEEHQIYDVYSFTAEANKASQRVMEKIGMTVYDHFELPNLSKYHLLKRQVRYYINLRK
    N315            KLAEEHQIYDVYSFTAEANKASQRVMEKIGMTVYDHFELPNLSKYHLLKRQVRYYINLRK
    NCTC8325        KLAEEHQIYDVYSFTAEANKASQRVMEKIGMTVYDHFELPNLSKYHLLKRQVRYYINLRK
    Newman          KLAEEHQIYDVYSFTAEANKASQRVMEKIGMTVYDHFELPNLSKYHLLKRQVRYYINLRK
    USA300_FPR3757  KLAEEHQIYDVYSFTAEANKASQRVMEKIGMTVYDHFELPNLSKYHLLKRQVRYYINLRK
                    ************************************************************