From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002567000
  • symbol?: uppP
  • description?: UDP pyrophosphate phosphatase

      descriptions from strain specific annotations:

    • UDP pyrophosphate phosphatase
    • undecaprenyl pyrophosphate phosphatase
    • bacitracin resistance protein: Undecaprenyl-diphosphatase
    • undecaprenyl-diphosphatase UppP
    • putative undecaprenol kinase
    • bacitracin resistance protein, undecaprenyl pyrophosphate phosphatase
  • strand?: -
  • coordinates?: 3077745..3078620
  • synteny block?: BlockID0018030
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0743 (uppP)
    N315:
    SA0638 (uppP)
    NCTC8325:
    Newman:
    NWMN_0652 (bacA)
    USA300_FPR3757:
    04-02981:
    SA2981_0660
    08BA02176:
    C248_0768 (bacA)
    11819-97:
    MS7_0735 (uppP)
    71193:
    ST398NM01_0761
    ECT-R 2:
    ECTR2_635 (uppP)
    ED133:
    SAOV_0718c
    ED98:
    SAAV_0646 (uppP)
    HO 5096 0412:
    SAEMRSA15_06090 (bacA)
    JH1:
    SaurJH1_0723
    JH9:
    SaurJH9_0707
    JKD6008:
    SAA6008_00700 (uppP)
    JKD6159:
    SAA6159_00638 (bacA)
    LGA251:
    SARLGA251_06160 (bacA)
    M013:
    M013TW_0670
    MRSA252:
    SAR0736 (uppP)
    MSHR1132:
    SAMSHR1132_06290
    MSSA476:
    SAS0648 (uppP)
    Mu3:
    SAHV_0680 (bacA)
    Mu50:
    SAV0683 (uppP)
    MW2:
    MW0645 (uppP)
    RF122:
    SAB0632c (bacA)
    ST398:
    SAPIG0761 (uppP)
    T0131:
    SAT0131_00754
    TCH60:
    HMPREF0772_12504 (uppP)
    TW20:
    SATW20_07580 (bacA)
    USA300_TCH1516:
    USA300HOU_0706 (bacA)
    VC40:
    SAVC_03050

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MFIIELIKGIILGVVEGLTEFAPVSSTGHMILVDDMWLKSSEFLGSQSAFTFKIVIQLGS
    N315            MFIIELIKGIILGVVEGLTEFAPVSSTGHMILVDDMWLKSSEFLGSQSAFTFKIVIQLGS
    NCTC8325        MFIIELIKGIILGVVEGLTEFAPVSSTGHMILVDDMWLKSSEFLGSQSAFTFKIVIQLGS
    Newman          MFIIELIKGIILGVVEGLTEFAPVSSTGHMILVDDMWLKSSEFLGSQSAFTFKIVIQLGS
    USA300_FPR3757  MFIIELIKGIILGVVEGLTEFAPVSSTGHMILVDDMWLKSSEFLGSQSAFTFKIVIQLGS
                    ************************************************************

    COL             VFAAAWVFRERFLEILHIGKHKHVEGDNDQQRRSKPRRLNLLHVLVGMVPAGILGLLFDD
    N315            VFAAAWVFRERFLEILHIGKHKHVEGENDQQRRSKPRRLNLLHVLVGMVPAGILGLLFDD
    NCTC8325        VFAAAWVFRERFLEILHIGKHKHVEGDNDQQRRSKPRRLNLLHVLVGMVPAGILGLLFDD
    Newman          VFAAAWVFRERFLEILHIGKHKHVEGDNDQQRRSKPRRLNLLHVLVGMVPAGILGLLFDD
    USA300_FPR3757  VFAAAWVFRERFLEILHIGKHKHVEGDNDQQRRSKPRRLNLLHVLVGMVPAGILGLLFDD
                    **************************:*********************************

    COL             FIEEHLFSVPTVMIGLFVGAIYMIIADKYSAKVKNPQTVDQISYFQAFVIGISQAVAMWP
    N315            FIEEHLFSVPTVMIGLFVGAIYMIIADKYSVKVKNPQTVDQINYFQAFVIGISQAVAMWP
    NCTC8325        FIEEHLFSVPTVMIGLFVGAIYMIIADKYSAKVKNPQTVDQISYFQAFVIGISQAVAMWP
    Newman          FIEEHLFSVPTVMIGLFVGAIYMIIADKYSAKVKNPQTVDQISYFQAFVIGISQAVAMWP
    USA300_FPR3757  FIEEHLFSVPTVMIGLFVGAIYMIIADKYSAKVKNPQTVDQISYFQAFVIGISQAVAMWP
                    ******************************.***********.*****************

    COL             GFSRSGSTISTGVLMKLNHKAASDFTFIMAVPIMLAASGLSLLKHYQDIQIADIPFYILG
    N315            GFSRSGSTISTGVLMKLNHKAASDFTFIMAVPIMLAASGLSLLKHYQDIQIADIPFYILG
    NCTC8325        GFSRSGSTISTGVLMKLNHKAASDFTFIMAVPIMLAASGLSLLKHYQDIQIADIPFYILG
    Newman          GFSRSGSTISTGVLMKLNHKAASDFTFIMAVPIMLAASGLSLLKHYQDIQIADIPFYILG
    USA300_FPR3757  GFSRSGSTISTGVLMKLNHKAASDFTFIMAVPIMLAASGLSLLKHYQDIQIADIPFYILG
                    ************************************************************

    COL             FLAAFTVGLIAIKTFLHQINKIKLIPFAIYRIVLVIFIAILYFGFGIGKGI
    N315            FLAAFTVGLIAIKTFLHLINKIKLIPFAIYRIVLVIFIAILYFGFGIGKGI
    NCTC8325        FLAAFTVGLIAIKTFLHLINKIKLIPFAIYRIVLVIFIAILYFGFGIGKGI
    Newman          FLAAFTVGLIAIKTFLHLINKIKLIPFAIYRIVLVIFIAILYFGFGIGKGI
    USA300_FPR3757  FLAAFTVGLIAIKTFLHLINKIKLIPFAIYRIVLVIFIAILYFGFGIGKGI
                    ***************** *********************************