From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002572000
  • symbol?:
  • description?: aldo/keto reductase

      descriptions from strain specific annotations:

    • aldo/keto reductase
    • aldo/keto reductase oxidoreductase
    • oxidoreductase
    • aldo/keto reductase family oxidoreductase
    • oxidoreductase ydhF
    • aldo/keto reductase family protein
    • oxidoreductase, aldo/keto reductase family
  • strand?: +
  • coordinates?: 3084010..3084918
  • synteny block?: BlockID0018080
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0665
    08BA02176:
    C248_0773
    11819-97:
    MS7_0740
    71193:
    ST398NM01_0766
    ECT-R 2:
    ECTR2_640
    ED133:
    SAOV_0723
    ED98:
    SAAV_0651
    HO 5096 0412:
    SAEMRSA15_06140
    JH1:
    SaurJH1_0728
    JH9:
    SaurJH9_0712
    JKD6008:
    SAA6008_00705
    JKD6159:
    SAA6159_00643
    LGA251:
    SARLGA251_06210
    M013:
    M013TW_0675
    MRSA252:
    SAR0741
    MSHR1132:
    SAMSHR1132_06340
    MSSA476:
    SAS0653
    Mu3:
    SAHV_0685
    Mu50:
    SAV0688
    MW2:
    MW0650
    RF122:
    SAB0637
    ST398:
    SAPIG0766
    T0131:
    SAT0131_00759
    TCH60:
    HMPREF0772_12499
    TW20:
    SATW20_07630
    USA300_TCH1516:
    USA300HOU_0711
    VC40:
    SAVC_03075

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MEQIMINHYVHFSRLVQGFWRANEWKMTAKELNYFINELVERGITTMDHADIYGDYQCES
    N315            MEQIMINHYVHFSRLVQGFWRANEWKMTAKELNYFINELVERGITTMDHADIYGDYQCES
    NCTC8325        MEQIMINHYVHFSRLVQGFWRANEWKMTAKELNYFINELVERGITTMDHADIYGDYQCES
    Newman          MEQIMINHYVHFSRLVQGFWRANEWKMTAKELNYFINELVERGITTMDHADIYGDYQCES
    USA300_FPR3757  MEQIMINHYVHFSRLVQGFWRANEWKMTAKELNYFINELVERGITTMDHADIYGDYQCES
                    ************************************************************

    COL             LFGNALDLSPELRNKIQIVTKCGIILPSKQFDFTNGHRYDLSSKHIVKSVEQSLINLNVD
    N315            LFGNALDLSPELRNKIQIVTKCGIILPSKQFDFTNGHRYDLSSKHIVKSVEQSLINLNVD
    NCTC8325        LFGNALDLSPELRNKIQIVTKCGIILPSKQFDFTNGHRYDLSSKHIVKSVEQSLINLNVD
    Newman          LFGNALDLSPELRNKIQIVTKCGIILPSKQFDFTNGHRYDLSSKHIVKSVEQSLINLNVD
    USA300_FPR3757  LFGNALDLSPELRNKIQIVTKCGIILPSKQFDFTNGHRYDLSSKHIVKSVEQSLINLNVD
                    ************************************************************

    COL             YLDSLLIHRPSPLMDPEQVADALTKLVKQGKLKSFGVSNFNHSQYQLLNQYIMKERLHIS
    N315            YLDSLLIHRPSPLMDPEQVADALTKLVKQGKLKSFGVSNFNHSQYQLLNQYIMKERLHIS
    NCTC8325        YLDSLLIHRPSPLMDPEQVADALTKLVKQGKLKSFGVSNFNHSQYQLLNQYIMKERLHIS
    Newman          YLDSLLIHRPSPLMDPEQVADALTKLVKQGKLKSFGVSNFNHSQYQLLNQYIMKERLHIS
    USA300_FPR3757  YLDSLLIHRPSPLMDPEQVADALTKLVKQGKLKSFGVSNFNHSQYQLLNQYIMKERLHIS
                    ************************************************************

    COL             INQLELSPYHVDSLQDGTMDSMYQNHVQIMAWSPFAGGKIFDKEDIKAQRIMKVVQSIAD
    N315            INQLELSPYHVDSLQDGTMDSMYQNHVQIMAWSPFAGGKIFDKEDIKAQRIMKVVQSIAD
    NCTC8325        INQLELSPYHVDSLQDGTMDSMYQNHVQIMAWSPFAGGKIFDKEDIKAQRIMKVVQSIAD
    Newman          INQLELSPYHVDSLQDGTMDSMYQNHVQIMAWSPFAGGKIFDKEDIKAQRIMKVVQSIAD
    USA300_FPR3757  INQLELSPYHVDSLQDGTMDSMYQNHVQIMAWSPFAGGKIFDKEDIKAQRIMKVVQSIAD
                    ************************************************************

    COL             KYGVSDTAVMIAWLVKIPHRIMPILGTSQLKRIDQAIEGLQLNLDDQSWFDIYTAIIGQD
    N315            KYGVSDTAVMIAWLVKIPHSIMPILGTSQLKRIDQAIEGLQLNLDDQSWFDIYTAIIGQD
    NCTC8325        KYGVSDTAVMIAWLVKIPHRIMPILGTSQLKRIDQAIEGLQLNLDDQSWFDIYTAIIGQD
    Newman          KYGVSDTAVMIAWLVKIPHRIMPILGTSQLKRIDQAIEGLQLNLDDQSWFDIYTAIIGQD
    USA300_FPR3757  KYGVSDTAVMIAWLVKIPHRIMPILGTSQLKRIDQAIEGLQLNLDDQSWFDIYTAIIVQD
                    ******************* ************************************* **

    COL             IP
    N315            IP
    NCTC8325        IP
    Newman          IP
    USA300_FPR3757  IP
                    **