Due to technical reasons this service will not be available for 7 days from 27 Nov to 04 Dec 2017
From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40

Summary[edit source | edit]

  • pan ID?: SAUPAN002576000
  • symbol?:
  • description?: hypothetical protein
  • strand?: -
  • coordinates?: 3089339..3089623
  • synteny block?: BlockID0018120
  • occurrence?: in 63% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0669
    08BA02176:
    11819-97:
    71193:
    ST398NM01_2834
    ECT-R 2:
    ED133:
    ED98:
    HO 5096 0412:
    SAEMRSA15_06180
    JH1:
    SaurJH1_0732
    JH9:
    SaurJH9_0716
    JKD6008:
    JKD6159:
    SAA6159_00647
    LGA251:
    SARLGA251_06250
    M013:
    MRSA252:
    SAR0745
    MSHR1132:
    MSSA476:
    SAS0657
    Mu3:
    SAHV_0689
    Mu50:
    SAV0692
    MW2:
    MW0654
    RF122:
    SAB0641c
    ST398:
    T0131:
    TCH60:
    HMPREF0772_12495
    TW20:
    SATW20_07670
    USA300_TCH1516:
    USA300HOU_0715
    VC40:
    SAVC_03095

Genome Viewer[edit source | edit]

N315 chromosome
NCTC8325 chromosome
Newman chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    N315            ---------------------MTINIIVLIVSIIVFQLIIGHIWHDIGLSYLRSILLMML
    NCTC8325        MFYGCHASSNSIIWKRSAFEQVTINIIVLIVSIIVFQLIIGHIWHDIGLSYLRSILLMML
    Newman          ---------------------MTINIIVLIVSIIVFQLIIGHIWHDIGLSYLRSILLMML
                                         :**************************************

    N315            PFGLGVFIQQVSYYERQYPKWQVPQNIKVRLKYIYLATFLEYVVLYLTLFTDILR
    NCTC8325        PFGLGVFIQQVSYYERQYPKWQVPQNIKVRLKYIYLATFLEYVVLYLTLFTDILR
    Newman          PFGLGVFIQQVSYYERQYPKWQVPQNIKVRLKYIYLATFLEYVVLYLTLFTDILR
                    *******************************************************