From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002578000
  • symbol?:
  • description?: DNA-binding protein
  • strand?: -
  • coordinates?: 3090433..3090855
  • synteny block?: BlockID0018140
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0671
    08BA02176:
    C248_0778
    11819-97:
    MS7_0745
    71193:
    ST398NM01_0771
    ECT-R 2:
    ECTR2_645
    ED133:
    SAOV_0728c
    ED98:
    SAAV_0656
    HO 5096 0412:
    SAEMRSA15_06200
    JH1:
    SaurJH1_0734
    JH9:
    SaurJH9_0718
    JKD6008:
    SAA6008_00710
    JKD6159:
    SAA6159_00649
    LGA251:
    SARLGA251_06270
    M013:
    M013TW_0680
    MRSA252:
    SAR0747
    MSHR1132:
    SAMSHR1132_06390
    MSSA476:
    SAS0659
    Mu3:
    SAHV_0691
    Mu50:
    SAV0694
    MW2:
    MW0656
    RF122:
    SAB0643c
    ST398:
    SAPIG0771
    T0131:
    SAT0131_00764
    TCH60:
    HMPREF0772_12493
    TW20:
    SATW20_07690
    USA300_TCH1516:
    USA300HOU_0717
    VC40:
    SAVC_03105

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKLQKSNHTILLVLEKGEDIVECITTFADDQDLTFTSVSGIGACDDVVLKFFNLTTKQYE
    N315            MKLQKSNHTILLVLEKGEDIVECITTFADDQDLTFTSVSGIGACDDVVLKFFNLTTKQYE
    NCTC8325        MKLQKSNHTILLVLEKGEDIVECITTFADDQDLTFTSVSGIGACDDVVLKFFNLTTKQYE
    Newman          MKLQKSNHTILLVLEKGEDIVECITTFADDQDLTFTSVSGIGACDDVVLKFFNLTTKQYE
    USA300_FPR3757  MKLQKSNHTILLVLEKGEDIVECITTFADDQDLTFTSVSGIGACDDVVLKFFNLTTKQYE
                    ************************************************************

    COL             EKHITEPLELTSLLGNISRLDNGHFAHLHATFGTQSYETFSGHLAKAIVSATAEIILTVT
    N315            EKHITEPLELTSLLGNISRLDNGHFAHLHATFGTQSYETFSGHLAKAIVSATAEIILTVT
    NCTC8325        EKHITEPLELTSLLGNISRLDNGHFAHLHATFGTQSYETFSGHLAKAIVSATAEIILTVT
    Newman          EKHITEPLELTSLLGNISRLDNGHFAHLHATFGTQSYETFSGHLAKAIVSATAEIILTVT
    USA300_FPR3757  EKHITEPLELTSLLGNISRLDNGHFAHLHATFGTQSYETFSGHLAKAIVSATAEIILTVT
                    ************************************************************

    COL             DLDIQRSFKDAVGLNLLDPQ
    N315            DLDIQRSFKDAVGLNLLDPQ
    NCTC8325        DLDIQRSFKDAVGLNLLDPQ
    Newman          DLDIQRSFKDAVGLNLLDPQ
    USA300_FPR3757  DLDIQRSFKDAVGLNLLDPQ
                    ********************