From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002581000
  • symbol?:
  • description?: transcriptional regulation protein

      descriptions from strain specific annotations:

    • transcriptional regulation protein
    • ybaK/ebsC protein
    • Transcriptional regulator
    • protein ebsC
    • putative prolyl-tRNA synthetase
    • ybaK / prolyl-tRNA synthetases associated domain protein
    • Regulatory protein
  • strand?: +
  • coordinates?: 3093276..3093758
  • synteny block?: BlockID0018170
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0674
    08BA02176:
    C248_0781
    11819-97:
    MS7_0748
    71193:
    ST398NM01_0774
    ECT-R 2:
    ECTR2_648
    ED133:
    SAOV_0731
    ED98:
    SAAV_0659
    HO 5096 0412:
    SAEMRSA15_06230
    JH1:
    SaurJH1_0737
    JH9:
    SaurJH9_0721
    JKD6008:
    SAA6008_00713
    JKD6159:
    SAA6159_00652
    LGA251:
    SARLGA251_06300
    M013:
    M013TW_0683
    MRSA252:
    SAR0750
    MSHR1132:
    SAMSHR1132_06420
    MSSA476:
    SAS0662
    Mu3:
    SAHV_0694
    Mu50:
    SAV0697
    MW2:
    MW0659
    RF122:
    SAB0646
    ST398:
    SAPIG0774 (ybaK)
    T0131:
    SAT0131_00767
    TCH60:
    HMPREF0772_12490 (ybaK)
    TW20:
    SATW20_07720
    USA300_TCH1516:
    USA300HOU_0720
    VC40:
    SAVC_03120

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MAKNKKTNAMRMLDRAKIKYEVHSFEVPEEHLSGQEVAELIQANVKTVFKTLVLENTKHE
    N315            MAKNKKTNAMRMLDRAKIKYEVHSFEVPEEHLSGAEVAELIQANVKTVFKTLVLENTKHE
    NCTC8325        MAKNKKTNAMRMLDRAKIKYEVHSFEVPEEHLSGQEVAELIQANVKTVFKTLVLENTKHE
    Newman          MAKNKKTNAMRMLDRAKIKYEVHSFEVPEEHLSGQEVAELIQANVKTVFKTLVLENTKHE
    USA300_FPR3757  MAKNKKTNAMRMLDRAKIKYEVHSFEVPEEHLSGQEVAELIQANVKTVFKTLVLENTKHE
                    ********************************** *************************

    COL             HFVFVIPVSETLDMKKAAALVGEKKLQLMPLDNLKNVTGYIRGGCSPVGMKTLFPTVVDK
    N315            HFVFVIPVSETLDMKKAAALVGEKKLQLMPLDNLKNVTGYIRGGCSPVGMKTLFPTVVDK
    NCTC8325        HFVFVIPVSETLDMKKAAALVGEKKLQLMPLDNLKNVTGYIRGGCSPVGMKTLFPTVVDK
    Newman          HFVFVIPVSETLDMKKAAALVGEKKLQLMPLDNLKNVTGYIRGGCSPVGMKTLFPTVVDK
    USA300_FPR3757  HFVFVIPVSETLDMKKAAALVGEKKLQLMPLDNLKNVTGYIRGGCSPVGMKTLFPTVVDK
                    ************************************************************

    COL             SCENYSHISVSGGLRTMQITIAVEDLITITKGKIGAVIHE
    N315            SCENYSHISVSGGLRTMQITIAVEDLITITKGKIGAVIHE
    NCTC8325        SCENYSHISVSGGLRTMQITIAVEDLITITKGKIGAVIHE
    Newman          SCENYSHISVSGGLRTMQITIAVEDLITITKGKIGAVIHE
    USA300_FPR3757  SCENYSHISVSGGLRTMQITIAVEDLITITKGKIGAVIHE
                    ****************************************