From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002584000
  • symbol?: fruA
  • description?: fructose specific permease

      descriptions from strain specific annotations:

    • fructose specific permease
    • PTS fructose transporter subunit IIC
    • PTS transport system, fructose-specific IIABC component
    • IIABC fructose/xylitol-PTS
    • pseudogene
    • PTS family fructose/mannitol (fru) porter component IIABC
    • PTS system, fructose-specific IIA component / PTS system, fructose-specific IIB component / PTS system, fructose-specific IIC component
    • PTS system D-fructose-specific transporter subunit IIABC
    • PTS system fructose/mannitol (fru) transporter subunit IIABC
    • PTS system fructose-specific transporter subunit IIABC
    • PTS system fructose subfamily transporter subunit IIC
    • PTS transport system fructose-specific transporter subunit IIABC
  • strand?: +
  • coordinates?: 3095735..3097714
  • synteny block?: BlockID0018200
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    SA0655 (fruA)
    NCTC8325:
    Newman:
    NWMN_0669 (fruA)
    USA300_FPR3757:
    04-02981:
    SA2981_0677 (fruA)
    08BA02176:
    C248_0784 (fruA)
    11819-97:
    MS7_0751 (fruA)
    71193:
    ST398NM01_0777
    ECT-R 2:
    ECTR2_651 (fruA)
    ED133:
    SAOV_0734
    ED98:
    SAAV_0662
    HO 5096 0412:
    SAEMRSA15_06260 (fruA)
    JH1:
    SaurJH1_0740
    JH9:
    SaurJH9_0724
    JKD6008:
    SAA6008_00716
    JKD6159:
    SAA6159_00655
    LGA251:
    SARLGA251_06330 (fruA)
    M013:
    M013TW_0686
    MRSA252:
    SAR0753 (fruA)
    MSHR1132:
    SAMSHR1132_06450
    MSSA476:
    SAS0665
    Mu3:
    SAHV_0697 (fruA)
    Mu50:
    SAV0700 (fruA)
    MW2:
    MW0662 (fruA)
    RF122:
    SAB0649 (fruA)
    ST398:
    SAPIG0777
    T0131:
    SAT0131_00770
    TCH60:
    HMPREF0772_12487 (fruA)
    TW20:
    SATW20_07750 (fruA)
    USA300_TCH1516:
    USA300HOU_0723 (fruA)
    VC40:
    SAVC_03135

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    N315            MRVTELLTKDTIAMDLMANDKNGVIDELVNQLDKAGKLSDVASFKEAIHNRESQSTTGIG
    NCTC8325        MRVTELLTKDTIAMDLMANDKNGVIDELVNQLDKAGKLSDVASFKEAIHNRESQSTTGIG
    Newman          MRVTELLTKDTIAMDLMANDKNGVIDELVNQLDKAGKLSDVASFKEAIHNRESQSTTGIG
    USA300_FPR3757  MRVTELLTKDTIAMDLMANDKNGVIDELVNQLDKAGKLSDVASFKEAIHNRESQSTTGIG
                    ************************************************************

    N315            EGIAIPHAKVAAVKSPAIAFGKSKEGVDYQSLDMQPAHLFFMIAAPEGGAQTHLDALAKL
    NCTC8325        EGIAIPHAKVAAVKSPAIAFGKSKAGVDYQSLDMQPAHLFFMIAAPEGGAQTHLDALAKL
    Newman          EGIAIPHAKVAAVKSPAIAFGKSKAGVDYQSLDMQPAHLFFMIAAPEGGAQTHLDALAKL
    USA300_FPR3757  EGIAIPHAKVAAVKSPAIAFGKSKAGVDYQSLDMQPAHLFFMIAAPEGGAQTHLDALAKL
                    ************************ ***********************************

    N315            SGILMDENVREKLLHASSPEEVLAIIDEADDEVTKEEEAEAEAQQVATAEQSSKQSNEPY
    NCTC8325        SGILMDENVREKLLHASSPEEVLAIIDEADDEVTKEEEAEAEAQQVATAEQSSKQSNEPY
    Newman          SGILMDENVREKLLHASSPEEVLAIIDEADDEVTKEEEAEAEAQQVATAEQSSKQSNEPY
    USA300_FPR3757  SGILMDENVREKLLHASSPEEVLAIIDEADDEVTKEEEAEAEAQQVATAEQSSKQSNEPY
                    ************************************************************

    N315            VLAVTACPTGIAHTYMARDALKKQADKMGIKIKVETNGSSGIKNHLTEQDIENATGIIVA
    NCTC8325        VLAVTACPTGIAHTYMARDALKKQADKMGIKIKVETNGSSGIKNHLTEQDIENATGIIVA
    Newman          VLAVTACPTGIAHTYMARDALKKQADKMGIKIKVETNGSSGIKNHLTEQDIENATGIIVA
    USA300_FPR3757  VLAVTACPTGIAHTYMARDALKKQADKMGIKIKVETNGSSGIKNHLTEQDIENATGIIVA
                    ************************************************************

    N315            ADVHVETDRFDGKNVVEVPVADGIKRPEELINKALDTSRKPFVARDGQRKGNSNDSQEKL
    NCTC8325        ADVHVETDRFDGKNVVEVPVADGIKRPEELINKALDTSRKPFVARDGQRKGNSNDSQEKL
    Newman          ADVHVETDRFDGKNVVEVPVADGIKRPEELINKALDTSRKPFVARDGQRKGNSNDSQEKL
    USA300_FPR3757  ADVHVETDRFDGKNVVEVPVADGIKRPEELINKALDTSRKPFVARDGQRKGNSNDSQEKL
                    ************************************************************

    N315            SPGKAFYKHLMNGVSNMLPLVISGGILMAIVFLFGANSFNPKSSEYNAFAEQLWNIGSKS
    NCTC8325        SPGKAFYKHLMNGVSNMLPLVISGGILMAIVFLFGANSFNPKSSEYNAFAEQLWNIGSKS
    Newman          SPGKAFYKHLMNGVSNMLPLVISGGILMAIVFLFGANSFNPKSSEYNAFAEQLWNIGSKS
    USA300_FPR3757  SPGKAFYKHLMNGVSNMLPLVISGGILMAIVFLFGANSFNPKSSEYNAFAEQLWNIGSKS
                    ************************************************************

    N315            AFALIIPILSGFIARSIADKPGFASGLVGGMLAISGGSGFIGGIIAGFLAGYLTQGVKAM
    NCTC8325        AFALIIPILSGFIARSIADKPGFASGLVGGMLAISGGSGFIGGIIAGFLAGYLTQGVKAM
    Newman          AFALIIPILSGFIARSIADKPGFASGLVGGMLAISGGSGFIGGIIAGFLAGYLTQGVKAM
    USA300_FPR3757  AFALIIPILSGFIARSIADKPGFASGLVGGMLAISGGSGFIGGIIAGFLAGYLTQGVKAM
                    ************************************************************

    N315            TRKLPQALEGLKPTLIYPLLTVTATGLLMIYVFNPPASWLNHLLLDGLNNLSGSNIVLLG
    NCTC8325        TRKLPQALEGLKPTLIYPLLTVTATGLLMIYAFNPPASWLNHLLLDGLNNLSGSNIVLLG
    Newman          TRKLPQALEGLKPTLIYPLLTVTATGLLMIYAFNPPASWLNHLLLDGLNNLSGSNIVLLG
    USA300_FPR3757  TRKLPQALEGLKPTLIYPLLTVTATGLLMIYAFNPPASWLNHLLLDGLNNLSGSNIVLLG
                    *******************************.****************************

    N315            LVIGAMMAIDMGGPFNKAAYVFATGALIEGNAAPITAAMIGGMIPPLAIATAMLIFRRKF
    NCTC8325        LVIGAMMAIDMGGPFNKAAYVFATGALIEGNAAPITAAMIGGMIPPLAIATAMLIFRRKF
    Newman          LVIGAMMAIDMGGPFNKAAYVFATGALIEGNAAPITAAMIGGMIPPLAIATAMLIFRRKF
    USA300_FPR3757  LVIGAMMAIDMGGPFNKAAYVFATGALIEGNAAPITAAMIGGMIPPLAIATAMLIFRRKF
                    ************************************************************

    N315            TKEQRGSIIPNYVMGMSFITEGAIPFAAADPLRVIPSMMIGSGIGGAIALGLGSRITAPH
    NCTC8325        TKEQRGSIIPNYVMGMSFITEGAIPFAAADPLRVIPSMMIGSGIGGAIALGLGSRITAPH
    Newman          TKEQRGSIIPNYVMGMSFITEGAIPFAAADPLRVIPSMMIGSGIGGAIALGLGSRITAPH
    USA300_FPR3757  TKEQRGSIIPNYVMGMSFITEGAIPFAAADPLRVIPSMMIGSGIGGAIALGLGSRITAPH
                    ************************************************************

    N315            GGIIVIVGTDGAHLLQTLIALLVGTLVSALIYGLIKPKLTETEIEASKSMDE
    NCTC8325        GGIIVIVGTDGAHLLQTLIALLVGTLVSALIYGLIKPKLTETEIEASKSMDE
    Newman          GGIIVIVGTDGAHLLQTLIALLVGTLVSALIYGLIKPKLTETEIEASKSMDE
    USA300_FPR3757  GGIIVIVGTDGAHLLQTLIALLVGTLVSALIYGLIKPKLTETEIEASKSMDE
                    ****************************************************