From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002602000
  • symbol?:
  • description?: hypothetical protein
  • strand?: +
  • coordinates?: 3111693..3111911
  • synteny block?: BlockID0018380
  • occurrence?: in 69% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0693
    08BA02176:
    C248_0800
    11819-97:
    MS7_0767
    71193:
    ST398NM01_0793
    ECT-R 2:
    ED133:
    SAOV_0750
    ED98:
    HO 5096 0412:
    SAEMRSA15_06420
    JH1:
    SaurJH1_0756
    JH9:
    JKD6008:
    JKD6159:
    LGA251:
    SARLGA251_06490
    M013:
    M013TW_0702
    MRSA252:
    SAR0769
    MSHR1132:
    SAMSHR1132_06610
    MSSA476:
    SAS0681
    Mu3:
    SAHV_0713
    Mu50:
    SAV0716
    MW2:
    MW0678
    RF122:
    SAB0665
    ST398:
    SAPIG0793
    T0131:
    TCH60:
    HMPREF0772_12471
    TW20:
    SATW20_07910
    USA300_TCH1516:
    USA300HOU_0739
    VC40:

Genome Viewer[edit source | edit]

N315 chromosome
NCTC8325 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    N315            MIIVYIVLLLILVYVNYRLVNRLLSENRIYVVRLIVTITTVISFILVYALIHELMPFVVR
    NCTC8325        MIIVYIVLLLILVYVNYRLVNRLLSENRIYVVRLIATITTVISFILVYALIHELMPFVVR
                    ***********************************.************************

    N315            AMDLMYHQ
    NCTC8325        AMDLMYHQ
                    ********