From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002603000
  • symbol?:
  • description?: Urea amidolyase

      descriptions from strain specific annotations:

    • Urea amidolyase
    • allophanate hydrolase subunit 1 family protein
    • putative allophanate hydrolase subunit 1
    • urea carboxylase
    • Kinase autophosphorylation inhibitor
    • allophanate hydrolase 2 subunit 1
  • strand?: +
  • coordinates?: 3112024..3112716
  • synteny block?: BlockID0018390
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0694
    08BA02176:
    C248_0801
    11819-97:
    MS7_0768
    71193:
    ST398NM01_0794
    ECT-R 2:
    ECTR2_667
    ED133:
    SAOV_0751
    ED98:
    SAAV_0678
    HO 5096 0412:
    SAEMRSA15_06430
    JH1:
    SaurJH1_0757
    JH9:
    SaurJH9_0740
    JKD6008:
    SAA6008_00732
    JKD6159:
    SAA6159_00671
    LGA251:
    SARLGA251_06500
    M013:
    M013TW_0703
    MRSA252:
    SAR0770
    MSHR1132:
    SAMSHR1132_06620
    MSSA476:
    SAS0682
    Mu3:
    SAHV_0714
    Mu50:
    SAV0717
    MW2:
    MW0679
    RF122:
    SAB0666
    ST398:
    SAPIG0794
    T0131:
    SAT0131_00786
    TCH60:
    HMPREF0772_12470
    TW20:
    SATW20_07920
    USA300_TCH1516:
    USA300HOU_0740
    VC40:
    SAVC_03215

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKIYSQGDQAIVVAIEKEVSKSLTEDLLTLRSYLIEQNYPFIIEIVPSESDMMIVYDARD
    N315            MKIYSQGDQAIVVAIEKEVSKSLTEDLLTLRSYLIEQNYPFIIEIVPSESDMMIVYDARD
    NCTC8325        MKIYSQGDQAIVVAIEKEVSKSLTEDLLTLRSYLIEQNYPFIIEIVPSESDMMIVYDARD
    Newman          MKIYSQGDQAIVVAIEKEVSKSLTEDLLTLRSYLIEQNYPFIIEIVPSESDMMIVYDARD
    USA300_FPR3757  MKIYSQGDQAIVVAIEKEVSKSLTEDLLTLRSYLIEQNYPFIIEIVPSESDMMIVYDARD
                    ************************************************************

    COL             MIKHHNIQSPFLYMKALIESIHLNIKHDFNQQDLIEIPIVYGSKYGPDLESLLKHYKIKL
    N315            MIKHHNIQSPFLYMKALIESIHLNIKHDFNQQDLIEIPIVYGSKYGPDIESLLKHYKIKL
    NCTC8325        MIKHHNIQSPFLYMKALIESIHLNIKHDFNQQDLIEIPIVYGSKYGPDLESLLKHYKIKL
    Newman          MIKHHNIQSPFLYMKALIESIHLNIKHDFNQQDLIEIPIVYGSKYGPDLESLLKHYKIKL
    USA300_FPR3757  MIKHHNIQSPFLYMKALIESIHLNIKHDFNQQDLIEIPIVYGSKYGPDLESLLKHYKIKL
                    ************************************************:***********

    COL             ETFIELHSKAQYFVSMMGYSPGFPYLTGLNKKLYINHTSKQKKFIPAGSVVLEGKKCGIV
    N315            ETFIELHSKTQYFVSMMGYSPGFPYLTGLNKKLYINHTSKQKKFIPAGSVVLEGKKCGIV
    NCTC8325        ETFIELHSKAQYFVSMMGYSPGFPYLTGLNKKLYINHTSKQKKFIPAGSVVLEGKKCGIV
    Newman          ETFIELHSKAQYFVSMMGYSPGFPYLTGLNKKLYINHTSKQKKFIPAGSVVLEGKKCGIV
    USA300_FPR3757  ETFIELHSKAQYFVSMMGYSPGFPYLTGLNKKLYINHTSKQKKFIPAGSVVLEGKKCGIV
                    *********:**************************************************

    COL             TTDTINDWLVIGYTPLSLFNPKESDFARLKLGDNIKFRPINENELEVGAFKDVNHN
    N315            TTDTINDWLVIGYTPLSLFNPKESDFARLKLGDNIKFRPINENELEVGAFKDVNHN
    NCTC8325        TTDTINDWLVIGYTPLSLFNPKESDFARLKLGDNIKFRPINENELEVGAFKDVNHN
    Newman          TTDTINDWLVIGYTPLSLFNPKESDFARLKLGDNIKFRPINENELEVGAFKDVNHN
    USA300_FPR3757  TTDTINDWLVIGYTPLSLFNPKESDFARLKLGDNIKFRPINENELEVGAFKDVNHN
                    ********************************************************