From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002604000
  • symbol?:
  • description?: allophanate hydrolase

      descriptions from strain specific annotations:

    • allophanate hydrolase
    • allophanate hydrolase 2 subunit 2
    • Allophanate hydrolase subunit 2
    • allophanate hydrolase subunit 2 family protein
    • putative allophanate hydrolase subunit 2
    • Regulator of kinase autophosphorylation inhibitor
    • urea amidolyase-related protein
  • strand?: +
  • coordinates?: 3112718..3113722
  • synteny block?: BlockID0018400
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0695
    08BA02176:
    C248_0802
    11819-97:
    MS7_0769
    71193:
    ST398NM01_0795
    ECT-R 2:
    ECTR2_668
    ED133:
    SAOV_0752
    ED98:
    SAAV_0679
    HO 5096 0412:
    SAEMRSA15_06440
    JH1:
    SaurJH1_0758
    JH9:
    SaurJH9_0741
    JKD6008:
    SAA6008_00733
    JKD6159:
    SAA6159_00672
    LGA251:
    SARLGA251_06510
    M013:
    M013TW_0704
    MRSA252:
    SAR0771
    MSHR1132:
    SAMSHR1132_06630
    MSSA476:
    SAS0683
    Mu3:
    SAHV_0715
    Mu50:
    SAV0718
    MW2:
    MW0680
    RF122:
    SAB0667
    ST398:
    SAPIG0795
    T0131:
    SAT0131_00787
    TCH60:
    HMPREF0772_12469
    TW20:
    SATW20_07930
    USA300_TCH1516:
    USA300HOU_0741
    VC40:
    SAVC_03220

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSIIIEKSGLFSSFQDFGRRGYEHDGVIPCGALDTLAHEIANRLVANDKNEATLEMTNKM
    N315            MSIIIEKSGLFSSFQDFGRRGYEHDGVIPCGALDTLAHEIANRLVANDKNEATLEMTNKM
    NCTC8325        MSIIIEKSGLFSSFQDFGRRGYEHDGVIPCGALDTLAHEIANRLVANDKNEATLEMTNKM
    Newman          MSIIIEKSGLFSSFQDFGRRGYEHDGVIPCGALDTLAHEIANRLVANDKNEATLEMTNKM
    USA300_FPR3757  MSIIIEKSGLFSSFQDFGRRGYEHDGVIPCGALDTLAHEIANRLVANDKNEATLEMTNKM
                    ************************************************************

    COL             ATIRFTEPTLIALAGGNVKAYTEHMTISPYKLYLLDKGDVLKFRETSYTSRVYLAVGGGF
    N315            ATIRFTEPTLIALAGGNVKAYTEHMTISPYKLYLLDKGDVLKFRETSYTSRVYLAVGGGF
    NCTC8325        ATIRFTEPTLIALAGGNVKAYTEHMTISPYKLYLLDKGDVLKFRETSYTSRVYLAVGGGF
    Newman          ATIRFTEPTLIALAGGNVKAYTEHMTISPYKLYLLDKGDVLKFRETSYTSRVYLAVGGGF
    USA300_FPR3757  ATIRFTEPTLIALAGGNVKAYTEHMTISPYKLYLLDKGDVLKFRETSYTSRVYLAVGGGF
                    ************************************************************

    COL             ELDAWLGSNSTDFNVKIGGFKGRTLQDGDEIKLKRDYTARHHKLFENLAHTKQTDWGIDG
    N315            ELDAWLGSNSTDFNVKIGGFKGRTLQDGDEIKLKRDYTARHHKLFENLAHTKQTDWGIDG
    NCTC8325        ELDAWLGSNSTDFNVKIGGFKGRTLQDGDEIKLKRDYTARHHKLFENLAHTKQTDWGIDG
    Newman          ELDAWLGSNSTDFNVKIGGFKGRTLQDGDEIKLKRDYTARHHKLFENLAHTKQTDWGIDG
    USA300_FPR3757  ELDAWLGSNSTDFNVKIGGFKGRTLQDGDEIKLKRDYTARHHKLFENLAHTKQTDWGIDG
                    ************************************************************

    COL             YALSFNYMSDVFHVVKNKGTEDFKEDAIQRFVKHDYKVTSKANRMGMMLEGEKIKAFYED
    N315            YALSFNYMSDVFHVVKNKGTEDFKEDAIQRFVKHDYKVTSKANRMGMMLEGEKIKAFYED
    NCTC8325        YALSFNYMSDVFHVVKNKGTEDFKEDAIQRFVKHDYKVTSKANRMGMMLEGEKIKAFYED
    Newman          YALSFNYMSDVFHVVKNKGTEDFKEDAIQRFVKHDYKVTSKANRMGMMLEGEKIKAFYED
    USA300_FPR3757  YALSFNYMSDVFHVVKNKGTEDFKEDAIQRFVKHDYKVTSKANRMGMMLEGEKIKAFYED
                    ************************************************************

    COL             MPPYQTVKKGTIQIKRDGTPIILLNDHYTLGSYPQIGTIASYHLTKLAQKPQGSRLKFQF
    N315            MPPYQTVKKGTIQIKRDGTPIILLNDHYTLGSYPQIGTIASYHLTKLAQKPQGSRLKFQF
    NCTC8325        MPPYQTVKKGTIQIKRDGTPIILLNDHYTLGSYPQIGTIASYHLTKLAQKPQGSRLKFQF
    Newman          MPPYQTVKKGTIQIKRDGTPIILLNDHYTLGSYPQIGTIASYHLTKLAQKPQGSRLKFQF
    USA300_FPR3757  MPPYQTVKKGTIQIKRDGTPIILLNDHYTLGSYPQIGTIASYHLTKLAQKPQGSRLKFQF
                    ************************************************************

    COL             IDILTAEKNLVKYSNWLNQLFHGIEYRMQLEMMK
    N315            IDILTAEKNLVKYSNWLNQLFHGIEYRMQLEMMK
    NCTC8325        IDILTAEKNLVKYSNWLNQLFHGIEYRMQLEMMK
    Newman          IDILTAEKNLVKYSNWLNQLFHGIEYRMQLEMMK
    USA300_FPR3757  IDILTAEKNLVKYSNWLNQLFHGIEYRMQLEMMK
                    **********************************