From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002607000
  • symbol?:
  • description?: ABC transporter ATP-binding protein

      descriptions from strain specific annotations:

    • ABC transporter ATP-binding protein
    • ABC superfamily ATP binding cassette transporter, ABC protein
    • ABC transporter, ATP-binding protein
    • ABC transporter ATP-binding protein uup
    • ABC transporter family protein
    • ATPase component of ABC transporters with duplicated ATPase domains
    • ATPase components of ABC transporterswith duplicated ATPase domains
    • ATP-binding ABC transporter protein
    • heme ABC transporter ATP-binding protein CcmA
  • strand?: +
  • coordinates?: 3116479..3118362
  • synteny block?: BlockID0018430
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0697
    08BA02176:
    C248_0804
    11819-97:
    MS7_0771
    71193:
    ST398NM01_0797
    ECT-R 2:
    ECTR2_670
    ED133:
    SAOV_0754
    ED98:
    SAAV_0681
    HO 5096 0412:
    SAEMRSA15_06460
    JH1:
    SaurJH1_0760
    JH9:
    SaurJH9_0743
    JKD6008:
    SAA6008_00735
    JKD6159:
    SAA6159_00674
    LGA251:
    SARLGA251_06530
    M013:
    M013TW_0706
    MRSA252:
    SAR0773
    MSHR1132:
    SAMSHR1132_06650
    MSSA476:
    SAS0685
    Mu3:
    SAHV_0717
    Mu50:
    SAV0720
    MW2:
    MW0682
    RF122:
    SAB0669
    ST398:
    SAPIG0797
    T0131:
    SAT0131_00789
    TCH60:
    HMPREF0772_12467
    TW20:
    SATW20_07950
    USA300_TCH1516:
    USA300HOU_0743
    VC40:
    SAVC_03230

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             --MEAYKIEHLNKSYADKTIFDNLDLSISEGEKIGLVGINGTGKSTLLKVIGGIDDDFTA
    N315            --MEAYKIEHLNKSYADKTIFDNLDLSISEGEKIGLVGINGTGKSTLLKVIGGIDDDFTA
    NCTC8325        MGMEAYKIEHLNKSYADKTIFDNLDLSISEGEKIGLVGINGTGKSTLLKVIGGIDDDFTA
    Newman          MGMEAYKIEHLNKSYADKTIFDNLDLSISEGEKIGLVGINGTGKSTLLKVIGGIDDDFTA
    USA300_FPR3757  MGMEAYKIEHLNKSYADKTIFDNLDLSISEGEKIGLVGINGTGKSTLLKVIGGIDDDFTA
                      **********************************************************

    COL             NVMHPNQYRIRYSSQKQDLNEDMTVFDAVLSSDTTTLRIIKQYEQAVQAYADDQSDKLFK
    N315            NVMHPNQYRIRYSSQKQDLNEDMTVFDAVLSSDTTTLRIIKQYEQAVQAYADDQSDKLFK
    NCTC8325        NVMHPNQYRIRYSSQKQDLNEDMTVFDAVLSSDTTTLRIIKQYEQAVQAYADDQSDKLFK
    Newman          NVMHPNQYRIRYSSQKQDLNEDMTVFDAVLSSDTTTLRIIKQYEQAVQAYADDQSDKLFK
    USA300_FPR3757  NVMHPNQYRIRYSSQKQDLNEDMTVFDAVLSSDTTTLRIIKQYEQAVQAYADDQSDKLFK
                    ************************************************************

    COL             RMMDAQDAMDQHDAWDYNAEIKTILSKLGIHDTTKYIKELSGGQQKRVVLAKTLIEQPDL
    N315            RMIDAQDAMDQHDAWDYNAEIKTILSKLGIHDTTKYIKELSGGQQKRVVLAKTLIEQPDL
    NCTC8325        RMMDAQDAMDQHDAWDYNAEIKTILSKLGIHDTTKYIKELSGGQQKRVVLAKTLIEQPDL
    Newman          RMMDAQDAMDQHDAWDYNAEIKTILSKLGIHDTTKYIKELSGGQQKRVVLAKTLIEQPDL
    USA300_FPR3757  RMMDAQDAMDQHDAWDYNAEIKTILSKLGIHDTTKYIKELSGGQQKRVVLAKTLIEQPDL
                    **:*********************************************************

    COL             LLLDEPTNHLDFESISWLINYVKQYPHTVLFVTHDRYFLNEVSTRIIELNRGKLASYPGN
    N315            LLLDEPTNHLDFESISWLINYVKQYPHTVLFVTHDRYFLNEVSTRIIELNRGKLASYPGN
    NCTC8325        LLLDEPTNHLDFESISWLINYVKQYPHTVLFVTHDRYFLNEVSTRIIELNRGKLASYPGN
    Newman          LLLDEPTNHLDFESISWLINYVKQYPHTVLFVTHDRYFLNEVSTRIIELNRGKLASYPGN
    USA300_FPR3757  LLLDEPTNHLDFESISWLINYVKQYPHTVLFVTHDRYFLNEVSTRIIELNRGKLASYPGN
                    ************************************************************

    COL             YESYIEMRAEREVTLQKQQQKQRALYKEELAWMRAGAKARTTKQQARINRFNDLENEVNQ
    N315            YESYIEMRAEREVTLQKQQQKQRALYKEELAWMRAGAKARTTKQQARINRFNDLENEVNQ
    NCTC8325        YESYIEMRAEREVTLQKQQQKQRALYKEELAWMRAGAKARTTKQQARINRFNDLENEVNQ
    Newman          YESYIEMRAEREVTLQKQQQKQRALYKEELAWMRAGAKARTTKQQARINRFNDLENEVNQ
    USA300_FPR3757  YESYIEMRAEREVTLQKQQQKQRALYKEELAWMRAGAKARTTKQQARINRFNDLENEVNQ
                    ************************************************************

    COL             QYKDDKGELNLAYSRLGKQVFELEDLSKAINDKVLFEHLTEIIQKGERIGVVGPNGAGKT
    N315            QYKDDKGELNLAYSRLGKQVFELEDLSKAINDKVLFEHLTEIIQKGERIGVVGPNGAGKT
    NCTC8325        QYKDDKGELNLAYSRLGKQVFELEDLSKAINDKVLFEHLTEIIQKGERIGVVGPNGAGKT
    Newman          QYKDDKGELNLAYSRLGKQVFELEDLSKAINDKVLFEHLTEIIQKGERIGVVGPNGAGKT
    USA300_FPR3757  QYKDDKGELNLAYSRLGKQVFELEDLSKAINDKVLIEHLTEIIQKGERIGVVGPNGAGKT
                    ***********************************:************************

    COL             TLLNILSGEDQQFEGKLKTGQTVKVAYFKQTDETLDRDIRMIDYLREENEIAKEKDGTSV
    N315            TLLNILSGEDQQFEGKLKTGQTVKVAYFKQTDETLDRDIRMIDYLREESEVAKEKDGTSV
    NCTC8325        TLLNILSGEDQQFEGKLKTGQTVKVAYFKQTDETLDRDIRMIDYLREESEIAKEKDGTSV
    Newman          TLLNILSGEDQQFEGKLKTGQTVKVAYFKQTDETLDRDIRMIDYLREENEIAKEKDGTSV
    USA300_FPR3757  TLLNILSGEDQQFEGKLKTGQTVKVAYFKQTDETLDRDIRMIDYLREENEIAKEKDGTSV
                    ************************************************.*:*********

    COL             SITQLLERFLFPSATHGKKVYKLSGGEQKRLYLLRLLVHQPNVLLLDEPTNDLDTETLTI
    N315            SITQLLERFLFPSATHGKKVYKLSGGEQKRLYLLRLLVHQPNVLLLDEPTNDLDTETLTI
    NCTC8325        SITQLLERFLFPSATHGKKVYKLSGGEQKRLYLLRLLVHQPNVLLLDEPTNDLDTETLTI
    Newman          SITQLLERFLFPSATHGKKVYKLSGGEQKRLYLLRLLVHQPNVLLLDEPTNDLDTETLTI
    USA300_FPR3757  SITQLLERFLFPSATHGKKVYKLSGGEQKRLYLLRLLVHQPNVLLLDEPTNDLDTETLTI
                    ************************************************************

    COL             LEDYIHTFGGTVITVSHDRYFLNKVAQSYWFIHDGQMEKIIGTFEDYESYKKSLDKNKST
    N315            LEDYIHTFGGTVITVSHDRYFLNKVAQSYWFIHDGQMEKIIGTFEDYESYKKSLDKNKST
    NCTC8325        LEDYIHTFGGTVITVSHDRYFLNKVAQSYWFIHDGQMEKIIGTFEDYESYKKSLDKNKST
    Newman          LEDYIHTFGGTVITVSHDRYFLNKVAQSYWFIHDGQMEKIIGTFEDYESYKKSLDKNKST
    USA300_FPR3757  LEDYIHTFGGTVITVSHDRYFLNKVAQSYWFIHDGQMEKIIGTFEDYESYKKSLDKNKST
                    ************************************************************

    COL             LKQQSKSSTTVRKKNGLSYKEKLEYEQLMKRIEQAEVRMEEIDVLMIEASADYGKIKELN
    N315            LKQQSKSYTTVRKKNGLSYKEKLEYEQLMKRIEQAEVRMEEIDVLMIEASADYGKIKELN
    NCTC8325        LKQQSKSSTTVRKKNGLSYKEKLEYEQLMKRIEQAEVRMEEIDVLMIEASADYGKIKELN
    Newman          LKQQSKSSTTVRKKNGLSYKEKLEYEQLMKRIEQAEVRMEEIDVLMIEASADYGKIKELN
    USA300_FPR3757  LKQQSKSSTTVRKKNGLSYKEKLEYEQLMKRIEQAEVRMEEIDVLMIEASADYGKIKELN
                    ******* ****************************************************

    COL             EEKEQLEIQYDLDITRWSELEEIKEQQ
    N315            EEKEQLEIQYDLDITRWSELEEIKEQQ
    NCTC8325        EEKEQLEIQYDLDITRWSELEEIKEQQ
    Newman          EEKEQLEIQYDLDITRWSELEEIKEQQ
    USA300_FPR3757  EEKEQLEIQYDLDITRWSELEEIKEQQ
                    ***************************